KEGG   Ornithorhynchus anatinus (platypus): 100081856Help
Entry
100081856         CDS       T01045                                 

Gene name
UGT2A1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100081856 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    100081856 (UGT2A1)
   00500 Starch and sucrose metabolism
    100081856 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100081856 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100081856 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    100081856 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100081856 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    100081856 (UGT2A1)
   00983 Drug metabolism - other enzymes
    100081856 (UGT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100081856 (UGT2A1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100081856 (UGT2A1)
Glycosyltransferases [BR:oaa01003]
 Others
  Hydrophobic molecule
   100081856 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 474 aa AA seqDB search
MPGKDALRLALSVMLLGTVLGGNVLIWPMEGSHWLNVKIVLGRLVEREHSVTVLVASGSL
FITPTPDSALHFEVYPVAFGKERLEGMIKSFVLTWLENRPTLTTIWRFYREMTKVIMDFH
EVTRELCDGVLANRELMERLRRGRFDVLLSDPVFPCGDLVALKLGIPFMYSLRFSPASTL
EKHCGKMPFPASYVPAVLSELTDRMSFGERVKNVLSYHLQDYIFNTLWAQWDSYYSQILD
GSHWLNIKIILEELIQRNHTVTVLVSTAPLFINSSADSPVTFELFPVPFGKHEIDSVIHD
LISLWLSHKPTSLTLWRFYKELGKLYERLFKINMQLCDGVLANQQLLAKLRRGRFDVLVS
DPVTICGDLIALNLGIPFLFTLRFTPASTVERHCGKIPSPASYVPAALSELTDRMPFGDR
VKNVLSYLLQDYIFQSYWGQWDSYYSKILGESEDPSLRFSSHFMSRIQDWRVAP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgccagggaaggacgctctgcggttggcgctgtccgtgatgctgctggggacggtgttg
ggagggaatgtgttgatctggcccatggaaggcagccactggctcaacgtgaagatcgtt
ctaggcagactggtggagagagagcacagcgtcactgttctggtcgcctccggctccctc
ttcatcacacccacccccgactccgctctccatttcgaggtgtatcccgtggcctttggg
aaggagaggctcgaaggaatgatcaagtcgttcgtcctgacctggctagagaaccgaccc
acgttgaccaccatctggcgattctacagggagatgaccaaggtcatcatggacttccac
gaggtgaccagggagctctgcgacggcgtgctggccaaccgggagttgatggagcggctg
aggcggggccgcttcgacgtgttgctgtcggaccccgtgttcccctgtggggacctggtg
gccctgaagctggggatccctttcatgtactctctgcggttctcgccggcctccaccttg
gagaagcactgcgggaagatgccgttccccgcctcctacgtgcctgccgtgctgtcggag
ctgacggatcggatgtccttcggcgagcgggtcaagaacgtcctctcttaccacctgcag
gactacatcttcaacactctctgggcgcagtgggattcctactacagccagattctcgat
ggaagccactggctgaatattaagatcattctagaagagctgattcagaggaaccacact
gttacggtgctagtttccacagctcccctcttcatcaactccagcgccgactcccccgta
actttcgagctgttcccggtgccctttggcaagcacgaaatagattccgtgatccacgat
ttgatctcgctgtggctgagccacaagcccacctccctgacgctctggagattctacaag
gagctgggaaaactgtacgaaaggttatttaagatcaatatgcagctctgtgacggagtc
cttgccaaccagcagttgctggctaaactgaggagggggcgtttcgacgtgttagtgtcg
gaccccgtcacgatctgcggggacctgattgctttgaacttggggatcccgtttctgttc
accctgagattcaccccggcctcaaccgtcgagagacactgcgggaaaatcccttctccc
gcctcctatgtgccggcggctctgtcagaactcaccgaccgcatgcccttcggggacaga
gtgaaaaacgttttatcgtaccttctgcaagactatatcttccagtcctactggggacag
tgggattcctactacagcaaaatcctgggtgagtctgaggatccctccttgcgtttctca
tcccattttatgtctcgaatccaggactggagggttgcaccctaa

DBGET integrated database retrieval system