KEGG   Ornithorhynchus anatinus (platypus): 100082089Help
Entry
100082089         CDS       T01045                                 

Gene name
THBS2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100082089 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100082089 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100082089 (THBS2)
  Cellular commiunity
   04510 Focal adhesion
    100082089 (THBS2)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100082089 (THBS2)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100082089 (THBS2)
  Exosomal proteins of colorectal cancer cells
   100082089 (THBS2)
  Exosomal proteins of bladder cancer cells
   100082089 (THBS2)
Heparan sulfate/heparin binding proteins [BR:oaa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100082089 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 980 aa AA seqDB search
MLTLSQRIRHEFDVSTTPISEQKIPVALYCVSGSLEHSAAEVNTINESTEVLHLTPEVIT
EFVGQKPEKKIEFCDHSCEELGNMFTELRGLRIVVSNLGENLQKVSEDNRILWEYIGSVP
KFKNQTFCWQDGRAFEDNEQWVVDSCTKCTCQYSKIVCHKITCPAVACANPFFVEDECCP
TCVHSKDGEEGWSPWSEWTECSVTCGSGTQQRGRSCDVTSNACIGPSIQTRMCSLGKCDN
RIRQNGGWSHWSPWSSCSVTCGIGNITRIRLCNSPVPQLGGKNCKGNGRETKTCEGPPCP
INGRWSPWSPWSTCSVTCAGGIRERSRLCNNPEPQYGGKDCVGDVKEHQMCNKQDCPIDG
CLSNPCFPGAECSSFPDGSWSCGPCPVGYLGNGTVCEDLDECTVVTDICFKSNNVHRCVN
TNPGFHCLPCPPRYKGSQPVGVGLEAARVEKQVCEPENPCKDKTHSCHKHAECIYLGHFS
DPMYKCECKTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIKDNCPHLPNSGQEDFD
KDGIGDACDDDDDSDGVDDEKDNCPLLFNPRQFDYDKDEVGDRCDNCPYVHNPAQIDTDN
NGEGDACAVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNPDQTDGDND
LVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDSDGKGDACDSDDDNDGIPDDRDNC
RLVFNPDQEDLDGDGRGDICKDDFDNDSIPDIDDVCPENNAISETDFRKFQMVHLDPKGT
TQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQ
SSSRFYVVMWKQVTQTYWEDKPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTDGQV
RTLWHDPKNVGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGL
FVFSQEMVFFSDLKYECRDV
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgctgacattatcccagagaattcgacatgagtttgatgtaagcaccactcctatttca
gagcagaaaattcctgtggctttgtattgtgtttctggaagtttagagcactctgcagct
gaagtgaataccatcaacgagagcactgaagtcctccacctgactcctgaagtcatcacg
gagtttgtgggccaaaagccagagaaaaagattgagttttgtgaccactcctgtgaggag
ctgggtaacatgtttacggaactcagaggcctccgcattgtagtgagcaatcttggcgaa
aacctgcagaaagtgtcggaggataatcgaattctctgggaatacattggctcggtcccc
aaattcaagaaccagacattctgctggcaagatggccgtgctttcgaggataatgaacaa
tgggtcgtagacagttgcaccaaatgcacatgccagtattccaaaattgtctgccacaaa
atcacctgcccagcagtcgcttgtgccaatccattcttcgttgaagatgaatgctgtcct
acttgtgtccactccaaagatggtgaagaaggttggtccccttggtcagaatggacagaa
tgctctgtcacatgtggttcaggaacccagcagagaggaaggtcatgtgatgtcaccagc
aatgcctgcatcggcccatccatccagacaaggatgtgcagccttggaaaatgtgacaat
cgcatccggcaaaatggtggctggagccactggtctccttggtcttcctgttctgttacc
tgcgggattggcaatatcacacgcatccgtctctgcaattccccagtccctcagttgggt
ggaaaaaactgtaaaggaaatgggcgggaaaccaagacatgcgaaggacccccctgtccc
attaatggtcgttggagcccatggtctccctggtctacctgttcagttacttgtgccgga
ggtatccgtgagaggtctcgcctctgcaataatcccgagccacagtacggaggaaaggac
tgtgtaggagatgtcaaggaacatcagatgtgcaataaacaggattgtccaattgatggc
tgcttgtcaaacccttgcttccccggagcagaatgcagcagttttcctgacggatcctgg
tcctgtggcccgtgccctgttggctatcttgggaatggcactgtctgtgaggatcttgat
gagtgtactgttgtcacagatatttgcttcaagtcaaacaacgttcatcgttgtgtgaac
accaaccctggattccactgcctgccgtgtcctccacgctacaaaggaagccagcctgtt
ggagttgggctggaggcagccagagtagaaaaacaagtgtgtgaacctgagaatccttgc
aaggacaagacccacagctgccacaagcatgcagaatgcatatacctggggcacttcagt
gaccctatgtacaagtgtgagtgtaagactggatatgcaggggatgggctcatctgtggg
gaagattcagatctggatggctggcccaataaaaacctggtctgtgctaccaatgccact
tatcactgcattaaggataattgtccacatctacctaactctggacaagaagattttgac
aaagatggaattggtgatgcatgcgatgatgatgatgacagtgatggtgtagatgatgag
aaggataattgccctctgctgttcaatccacgccagtttgattatgacaaggatgaggtc
ggagatcgctgtgataactgcccctacgtgcacaaccctgctcagattgacacagacaat
aacggggaaggtgatgcttgtgctgtggatattgatggtgatgatgtttttaatgagcga
gacaactgtccctacgtctataacactgaccagcgggacactgatggggatggagtaggg
gatcactgtgataactgccccttagtgcataatcctgaccagactgatggggataatgat
ctcgttggagaccagtgtgataacaatgaggacatagatgaagatggtcatcaaaacaac
caagacaattgcccctacatctccaatgccaatcaggcagaccacgacagtgatgggaaa
ggagacgcctgtgattctgatgatgacaatgatggcattccagatgacagggacaactgc
cggctcgtgttcaatcctgaccaggaagatttagatggtgacggacgaggtgatatttgt
aaagatgattttgacaatgacagcatcccagatattgatgatgtatgtcctgaaaacaat
gccatcagtgagactgatttcagaaagttccagatggtccatcttgatcccaagggcact
actcaaatcgaccccaactgggttattcgccaccagggcaaggaactagtgcagactgcc
aactctgatccaggcattgctgttggtttcgatgagtttggctctgttgacttcagtggc
acgttctatgtcaataccgatcgtgacgatgactatgctggatttgtatttggataccag
tctagcagcaggttttatgtggttatgtggaagcaggtcacccagacttactgggaggac
aaacccaccagggcttatggctactctggcgtatccctcaaagtggtgaactccacaacc
gggaccggagagcatttgaggaatgctctatggcacacgggaaatacagatgggcaggtg
agaactttgtggcatgacccgaaaaatgtaggctggaaggattacactgcctacaggtgg
catctaacccacaggcccaaaacaggttacataagagtactagtgcatgaagggaaacag
gtcatggcagactctggaccaatttatgaccagacttatgctggtggacggttaggtctc
tttgtcttctctcaagaaatggtcttcttctccgacctcaaatatgaatgccgagatgtc
tga

DBGET integrated database retrieval system