KEGG   Ornithorhynchus anatinus (platypus): 100082089Help
Entry
100082089         CDS       T01045                                 

Gene name
THBS2
Definition
(RefSeq) thrombospondin 2
  KO
K04659  thrombospondin 2/3/4/5
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04145  Phagosome
oaa04151  PI3K-Akt signaling pathway
oaa04510  Focal adhesion
oaa04512  ECM-receptor interaction
oaa05144  Malaria
oaa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100082089 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100082089 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100082089 (THBS2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100082089 (THBS2)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    100082089 (THBS2)
   05144 Malaria
    100082089 (THBS2)
Membrane trafficking [BR:oaa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100082089 (THBS2)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100082089 (THBS2)
  Exosomal proteins of colorectal cancer cells
   100082089 (THBS2)
  Exosomal proteins of bladder cancer cells
   100082089 (THBS2)
Glycosaminoglycan binding proteins [BR:oaa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100082089 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC EGF_3 EGF_CA EGF
Motif
Other DBs
NCBI-GeneID: 100082089
NCBI-ProteinID: XP_001512789
Position
Un
AA seq 980 aa AA seqDB search
MLTLSQRIRHEFDVSTTPISEQKIPVALYCVSGSLEHSAAEVNTINESTEVLHLTPEVIT
EFVGQKPEKKIEFCDHSCEELGNMFTELRGLRIVVSNLGENLQKVSEDNRILWEYIGSVP
KFKNQTFCWQDGRAFEDNEQWVVDSCTKCTCQYSKIVCHKITCPAVACANPFFVEDECCP
TCVHSKDGEEGWSPWSEWTECSVTCGSGTQQRGRSCDVTSNACIGPSIQTRMCSLGKCDN
RIRQNGGWSHWSPWSSCSVTCGIGNITRIRLCNSPVPQLGGKNCKGNGRETKTCEGPPCP
INGRWSPWSPWSTCSVTCAGGIRERSRLCNNPEPQYGGKDCVGDVKEHQMCNKQDCPIDG
CLSNPCFPGAECSSFPDGSWSCGPCPVGYLGNGTVCEDLDECTVVTDICFKSNNVHRCVN
TNPGFHCLPCPPRYKGSQPVGVGLEAARVEKQVCEPENPCKDKTHSCHKHAECIYLGHFS
DPMYKCECKTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIKDNCPHLPNSGQEDFD
KDGIGDACDDDDDSDGVDDEKDNCPLLFNPRQFDYDKDEVGDRCDNCPYVHNPAQIDTDN
NGEGDACAVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNPDQTDGDND
LVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDSDGKGDACDSDDDNDGIPDDRDNC
RLVFNPDQEDLDGDGRGDICKDDFDNDSIPDIDDVCPENNAISETDFRKFQMVHLDPKGT
TQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQ
SSSRFYVVMWKQVTQTYWEDKPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTDGQV
RTLWHDPKNVGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGL
FVFSQEMVFFSDLKYECRDV
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgctgacattatcccagagaattcgacatgagtttgatgtaagcaccactcctatttca
gagcagaaaattcctgtggctttgtattgtgtttctggaagtttagagcactctgcagct
gaagtgaataccatcaacgagagcactgaagtcctccacctgactcctgaagtcatcacg
gagtttgtgggccaaaagccagagaaaaagattgagttttgtgaccactcctgtgaggag
ctgggtaacatgtttacggaactcagaggcctccgcattgtagtgagcaatcttggcgaa
aacctgcagaaagtgtcggaggataatcgaattctctgggaatacattggctcggtcccc
aaattcaagaaccagacattctgctggcaagatggccgtgctttcgaggataatgaacaa
tgggtcgtagacagttgcaccaaatgcacatgccagtattccaaaattgtctgccacaaa
atcacctgcccagcagtcgcttgtgccaatccattcttcgttgaagatgaatgctgtcct
acttgtgtccactccaaagatggtgaagaaggttggtccccttggtcagaatggacagaa
tgctctgtcacatgtggttcaggaacccagcagagaggaaggtcatgtgatgtcaccagc
aatgcctgcatcggcccatccatccagacaaggatgtgcagccttggaaaatgtgacaat
cgcatccggcaaaatggtggctggagccactggtctccttggtcttcctgttctgttacc
tgcgggattggcaatatcacacgcatccgtctctgcaattccccagtccctcagttgggt
ggaaaaaactgtaaaggaaatgggcgggaaaccaagacatgcgaaggacccccctgtccc
attaatggtcgttggagcccatggtctccctggtctacctgttcagttacttgtgccgga
ggtatccgtgagaggtctcgcctctgcaataatcccgagccacagtacggaggaaaggac
tgtgtaggagatgtcaaggaacatcagatgtgcaataaacaggattgtccaattgatggc
tgcttgtcaaacccttgcttccccggagcagaatgcagcagttttcctgacggatcctgg
tcctgtggcccgtgccctgttggctatcttgggaatggcactgtctgtgaggatcttgat
gagtgtactgttgtcacagatatttgcttcaagtcaaacaacgttcatcgttgtgtgaac
accaaccctggattccactgcctgccgtgtcctccacgctacaaaggaagccagcctgtt
ggagttgggctggaggcagccagagtagaaaaacaagtgtgtgaacctgagaatccttgc
aaggacaagacccacagctgccacaagcatgcagaatgcatatacctggggcacttcagt
gaccctatgtacaagtgtgagtgtaagactggatatgcaggggatgggctcatctgtggg
gaagattcagatctggatggctggcccaataaaaacctggtctgtgctaccaatgccact
tatcactgcattaaggataattgtccacatctacctaactctggacaagaagattttgac
aaagatggaattggtgatgcatgcgatgatgatgatgacagtgatggtgtagatgatgag
aaggataattgccctctgctgttcaatccacgccagtttgattatgacaaggatgaggtc
ggagatcgctgtgataactgcccctacgtgcacaaccctgctcagattgacacagacaat
aacggggaaggtgatgcttgtgctgtggatattgatggtgatgatgtttttaatgagcga
gacaactgtccctacgtctataacactgaccagcgggacactgatggggatggagtaggg
gatcactgtgataactgccccttagtgcataatcctgaccagactgatggggataatgat
ctcgttggagaccagtgtgataacaatgaggacatagatgaagatggtcatcaaaacaac
caagacaattgcccctacatctccaatgccaatcaggcagaccacgacagtgatgggaaa
ggagacgcctgtgattctgatgatgacaatgatggcattccagatgacagggacaactgc
cggctcgtgttcaatcctgaccaggaagatttagatggtgacggacgaggtgatatttgt
aaagatgattttgacaatgacagcatcccagatattgatgatgtatgtcctgaaaacaat
gccatcagtgagactgatttcagaaagttccagatggtccatcttgatcccaagggcact
actcaaatcgaccccaactgggttattcgccaccagggcaaggaactagtgcagactgcc
aactctgatccaggcattgctgttggtttcgatgagtttggctctgttgacttcagtggc
acgttctatgtcaataccgatcgtgacgatgactatgctggatttgtatttggataccag
tctagcagcaggttttatgtggttatgtggaagcaggtcacccagacttactgggaggac
aaacccaccagggcttatggctactctggcgtatccctcaaagtggtgaactccacaacc
gggaccggagagcatttgaggaatgctctatggcacacgggaaatacagatgggcaggtg
agaactttgtggcatgacccgaaaaatgtaggctggaaggattacactgcctacaggtgg
catctaacccacaggcccaaaacaggttacataagagtactagtgcatgaagggaaacag
gtcatggcagactctggaccaatttatgaccagacttatgctggtggacggttaggtctc
tttgtcttctctcaagaaatggtcttcttctccgacctcaaatatgaatgccgagatgtc
tga

DBGET integrated database retrieval system