KEGG   Ornithorhynchus anatinus (platypus): 100082089Help
Entry
100082089         CDS       T01045                                 

Definition
thrombospondin-2-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:oaa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:oaa04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:oaa04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:oaa04510]
Human Diseases; Infectious diseases; Malaria [PATH:oaa05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 980 aa AA seqDB search
MLTLSQRIRHEFDVSTTPISEQKIPVALYCVSGSLEHSAAEVNTINESTEVLHLTPEVIT
EFVGQKPEKKIEFCDHSCEELGNMFTELRGLRIVVSNLGENLQKVSEDNRILWEYIGSVP
KFKNQTFCWQDGRAFEDNEQWVVDSCTKCTCQYSKIVCHKITCPAVACANPFFVEDECCP
TCVHSKDGEEGWSPWSEWTECSVTCGSGTQQRGRSCDVTSNACIGPSIQTRMCSLGKCDN
RIRQNGGWSHWSPWSSCSVTCGIGNITRIRLCNSPVPQLGGKNCKGNGRETKTCEGPPCP
INGRWSPWSPWSTCSVTCAGGIRERSRLCNNPEPQYGGKDCVGDVKEHQMCNKQDCPIDG
CLSNPCFPGAECSSFPDGSWSCGPCPVGYLGNGTVCEDLDECTVVTDICFKSNNVHRCVN
TNPGFHCLPCPPRYKGSQPVGVGLEAARVEKQVCEPENPCKDKTHSCHKHAECIYLGHFS
DPMYKCECKTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIKDNCPHLPNSGQEDFD
KDGIGDACDDDDDSDGVDDEKDNCPLLFNPRQFDYDKDEVGDRCDNCPYVHNPAQIDTDN
NGEGDACAVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNPDQTDGDND
LVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDSDGKGDACDSDDDNDGIPDDRDNC
RLVFNPDQEDLDGDGRGDICKDDFDNDSIPDIDDVCPENNAISETDFRKFQMVHLDPKGT
TQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQ
SSSRFYVVMWKQVTQTYWEDKPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTDGQV
RTLWHDPKNVGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGL
FVFSQEMVFFSDLKYECRDV
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgctgacattatcccagagaattcgacatgagtttgatgtaagcaccactcctatttca
gagcagaaaattcctgtggctttgtattgtgtttctggaagtttagagcactctgcagct
gaagtgaataccatcaacgagagcactgaagtcctccacctgactcctgaagtcatcacg
gagtttgtgggccaaaagccagagaaaaagattgagttttgtgaccactcctgtgaggag
ctgggtaacatgtttacggaactcagaggcctccgcattgtagtgagcaatcttggcgaa
aacctgcagaaagtgtcggaggataatcgaattctctgggaatacattggctcggtcccc
aaattcaagaaccagacattctgctggcaagatggccgtgctttcgaggataatgaacaa
tgggtcgtagacagttgcaccaaatgcacatgccagtattccaaaattgtctgccacaaa
atcacctgcccagcagtcgcttgtgccaatccattcttcgttgaagatgaatgctgtcct
acttgtgtccactccaaagatggtgaagaaggttggtccccttggtcagaatggacagaa
tgctctgtcacatgtggttcaggaacccagcagagaggaaggtcatgtgatgtcaccagc
aatgcctgcatcggcccatccatccagacaaggatgtgcagccttggaaaatgtgacaat
cgcatccggcaaaatggtggctggagccactggtctccttggtcttcctgttctgttacc
tgcgggattggcaatatcacacgcatccgtctctgcaattccccagtccctcagttgggt
ggaaaaaactgtaaaggaaatgggcgggaaaccaagacatgcgaaggacccccctgtccc
attaatggtcgttggagcccatggtctccctggtctacctgttcagttacttgtgccgga
ggtatccgtgagaggtctcgcctctgcaataatcccgagccacagtacggaggaaaggac
tgtgtaggagatgtcaaggaacatcagatgtgcaataaacaggattgtccaattgatggc
tgcttgtcaaacccttgcttccccggagcagaatgcagcagttttcctgacggatcctgg
tcctgtggcccgtgccctgttggctatcttgggaatggcactgtctgtgaggatcttgat
gagtgtactgttgtcacagatatttgcttcaagtcaaacaacgttcatcgttgtgtgaac
accaaccctggattccactgcctgccgtgtcctccacgctacaaaggaagccagcctgtt
ggagttgggctggaggcagccagagtagaaaaacaagtgtgtgaacctgagaatccttgc
aaggacaagacccacagctgccacaagcatgcagaatgcatatacctggggcacttcagt
gaccctatgtacaagtgtgagtgtaagactggatatgcaggggatgggctcatctgtggg
gaagattcagatctggatggctggcccaataaaaacctggtctgtgctaccaatgccact
tatcactgcattaaggataattgtccacatctacctaactctggacaagaagattttgac
aaagatggaattggtgatgcatgcgatgatgatgatgacagtgatggtgtagatgatgag
aaggataattgccctctgctgttcaatccacgccagtttgattatgacaaggatgaggtc
ggagatcgctgtgataactgcccctacgtgcacaaccctgctcagattgacacagacaat
aacggggaaggtgatgcttgtgctgtggatattgatggtgatgatgtttttaatgagcga
gacaactgtccctacgtctataacactgaccagcgggacactgatggggatggagtaggg
gatcactgtgataactgccccttagtgcataatcctgaccagactgatggggataatgat
ctcgttggagaccagtgtgataacaatgaggacatagatgaagatggtcatcaaaacaac
caagacaattgcccctacatctccaatgccaatcaggcagaccacgacagtgatgggaaa
ggagacgcctgtgattctgatgatgacaatgatggcattccagatgacagggacaactgc
cggctcgtgttcaatcctgaccaggaagatttagatggtgacggacgaggtgatatttgt
aaagatgattttgacaatgacagcatcccagatattgatgatgtatgtcctgaaaacaat
gccatcagtgagactgatttcagaaagttccagatggtccatcttgatcccaagggcact
actcaaatcgaccccaactgggttattcgccaccagggcaaggaactagtgcagactgcc
aactctgatccaggcattgctgttggtttcgatgagtttggctctgttgacttcagtggc
acgttctatgtcaataccgatcgtgacgatgactatgctggatttgtatttggataccag
tctagcagcaggttttatgtggttatgtggaagcaggtcacccagacttactgggaggac
aaacccaccagggcttatggctactctggcgtatccctcaaagtggtgaactccacaacc
gggaccggagagcatttgaggaatgctctatggcacacgggaaatacagatgggcaggtg
agaactttgtggcatgacccgaaaaatgtaggctggaaggattacactgcctacaggtgg
catctaacccacaggcccaaaacaggttacataagagtactagtgcatgaagggaaacag
gtcatggcagactctggaccaatttatgaccagacttatgctggtggacggttaggtctc
tttgtcttctctcaagaaatggtcttcttctccgacctcaaatatgaatgccgagatgtc
tga

DBGET integrated database retrieval system