KEGG   Ornithorhynchus anatinus (platypus): 100082161Help
Entry
100082161         CDS       T01045                                 

Definition
histone H2B type 1-A-like
Orthology
K11252  
histone H2B
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:oaa05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:oaa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:oaa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 134 aa AA seqDB search
MDPMMARVTGSSGNRKKSRSQNPPKRSYNHCPKGSYFLYINKILKLVHPEKTISSKTLEV
VNTFINDIFERLAAKASRLVHKKRHLTLQIWAIQEAVDLLLPGELAKYATAHGNKAVERY
KASKKMQPSSPEAS
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggatcctatgatggctcgagtcaccggatcctcaggaaatcgcaagaaatcgaggtcc
caaaaccccccaaaacggagctataatcactgcccgaaggggagttacttcctttacata
aacaagattctgaagctcgtccaccctgagaagaccatctcctccaagaccctggaagtc
gtgaacacattcataaatgatatcttcgagcgacttgctgctaaggcatcccggcttgtg
cacaaaaaaaggcatttaactctccagatctgggcgatccaggaggccgtggacttgctc
ctgcctggggagctagccaaatatgccacagctcatggcaacaaggcagttgaaagatac
aaggcctccaaaaagatgcagcccagttctccagaggcgagctga

DBGET integrated database retrieval system