KEGG   Ornithorhynchus anatinus (platypus): 100082161Help
Entry
100082161         CDS       T01045                                 

Definition
histone H2B-like
Orthology
K11252  
histone H2B
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100082161
  Immune diseases
   05322 Systemic lupus erythematosus
    100082161
  Substance dependence
   05034 Alcoholism
    100082161
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100082161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 134 aa AA seqDB search
MDPMMARVTGSSGNRKKSRSQNPPKRSYNHCPKGSYFLYINKILKLVHPEKTISSKTLEV
VNTFINDIFERLAAKASRLVHKKRHLTLQIWAIQEAVDLLLPGELAKYATAHGNKAVERY
KASKKMQPSSPEAS
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggatcctatgatggctcgagtcaccggatcctcaggaaatcgcaagaaatcgaggtcc
caaaaccccccaaaacggagctataatcactgcccgaaggggagttacttcctttacata
aacaagattctgaagctcgtccaccctgagaagaccatctcctccaagaccctggaagtc
gtgaacacattcataaatgatatcttcgagcgacttgctgctaaggcatcccggcttgtg
cacaaaaaaaggcatttaactctccagatctgggcgatccaggaggccgtggacttgctc
ctgcctggggagctagccaaatatgccacagctcatggcaacaaggcagttgaaagatac
aaggcctccaaaaagatgcagcccagttctccagaggcgagctga

DBGET integrated database retrieval system