KEGG   Ornithorhynchus anatinus (platypus): 100082172Help
Entry
100082172         CDS       T01045                                 

Gene name
EHHADH
Definition
enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:oaa01200]
Metabolism; Overview; Fatty acid metabolism [PATH:oaa01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:oaa00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:oaa00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:oaa00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:oaa00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:oaa00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:oaa00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:oaa00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:oaa04146]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:oaa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 704 aa AA seqDB search
MAVEHLMCVAVQHGLREELKKAERDSSVKAIVICGADGKFSSGADICGFRTGKVSVLGLL
VDELQKMEKPVVAAIEGMAFGGSLEISLGCHYRIAHAKALVGFPEVTIGLLPGARGTQLL
PRLIGVPAALDMITSGRHLLAPEALKLGLLDQVVNSDTVEAAIKFAEQISGQPTESRRIM
NKQVPELPNMDSIFSEAYLKMRKQFPGCISREACVRAVQAAVQYPYPLGIEKEKDLFQYL
HTSGQAKALQYLFFAQRICNKWSTSSGASWKNSSAQPIRSAAVIGLGTMGRGIVVSLARA
NIPVIAVEQDEKQLELASRMVSFLLELEASKMQKSGQSWAAPKPRFTMSLEELGEVDLVI
EAVFEEIGLKKQVFSKLSAICKPEAFLCTNTSALNIDEIASSTRHPQRVIGTHFFSPAHV
MTLLEVIPGRRSSPTTIATVMSLAKTMKKVGVVVGNCFGFVGNRMLFPYVQQTYFLLEEG
SQPEEVDRVLEEFGFKMGPFRVSDLAGLDIGWKSRQGQGLTGPTLAPGTPARQRGRKRYC
PIPDMLCEQGRFGQKTGKGWYRYDRPMGRIHKPDPWLSKFLSEYRKTHHIETRPISQDEI
LERCLYALINEGFRILGEGIAAGPEHVDCIYINGFGWPKHTGGPMFYASTVGLPTVLEKL
QKYYRSNPDIPQLEPSHFLKKLASQGNPPLHKWKSMVGLQASKL
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggaacatctcatgtgtgtggcagtacagcatggattaagagaagaactgaaa
aaagctgaaagagacagcagtgtgaaagctattgtaatttgtggagcagatggcaagttc
tcgtcaggtgccgatatttgtggttttcgaactggaaaggtgtctgtattgggcctgcta
gttgatgagttacaaaaaatggaaaaaccagtggtggctgccattgaaggcatggcattt
ggagggagtctagagatatctttgggctgtcactatagaattgcccacgcaaaggctctt
gttggtttccccgaggtcactattggccttctccccggtgcaagaggaacccagcttctc
cccagactcattggggtaccagctgccctggacatgattacctcaggaagacaccttctg
gctcctgaagcactcaagctgggtcttctagatcaggtggtgaattcagacacggtcgag
gcagcaatcaagtttgcagaacaaatttcaggtcaacccacagagtctcgtcggatcatg
aataaacaagttccagagctgcccaacatggactccatcttcagcgaagcctacctgaag
atgaggaagcagttccccgggtgtatttccagagaagcctgcgtccgggcggtccaggct
gccgtgcagtatccctatcccctagggattgagaaggagaaagatctttttcaatatctt
cacacctcggggcaagcaaaagcacttcagtatctcttctttgctcaaagaatctgcaac
aagtggtcaacttcctctggagcatcctggaagaattcttcagctcaacccatccggtct
gcagctgtaataggtttgggaacaatgggccgaggcatcgtggtttctctggcgagggcc
aatatcccagtgatcgctgtggaacaggacgagaaacaactggaactggctagtagaatg
gtatccttcctcttggagctggaggcttccaaaatgcagaaaagtggccagagctgggcc
gccccaaagcccaggttcactatgtctctggaggagctgggggaggtggatttagttatc
gaggccgtgtttgaggaaataggcttgaagaaacaggttttcagcaaactgtcagccatc
tgcaagccagaggccttcctgtgcaccaacacgtcggccctaaacatcgacgagatcgcc
tcctccacccggcatcctcagcgggtcatcggcactcacttcttctccccggcccacgtc
atgaccttgttagaggtcatccccggccgccgctcgtcccccacgactatcgccaccgtc
atgagcctggccaaaaccatgaagaaagtcggggttgtggtaggaaactgctttggattc
gttgggaaccggatgttgtttccatatgtccagcagacctatttcttgttggaagagggc
agtcagccggaggaggtggaccgggtcctggaggagttcggctttaagatgggccccttc
agagtatccgatctggccgggctcgatataggttggaaatctcggcagggccagggcctg
accgggcccaccctggctccggggaccccggctcggcaacggggccgcaaaagatattgc
ccgattcccgacatgctctgtgaacaggggagatttggtcagaagaccggcaaaggctgg
taccgatacgacagacccatgggtaggattcacaagccggatccctggctttctaaattc
ttgtccgagtataggaaaacccaccacatcgaaacccgccccatcagccaagatgagatc
ctggagcgctgcctgtatgctctcatcaacgaaggcttccgcatcttaggagaagggata
gcggctggcccagaacacgttgattgcatttacatcaatggatttgggtggccaaagcat
accggcggccccatgttttatgcttctacggttggcctgcccaccgtcctggaaaaactg
cagaagtattacagaagcaatcccgatatcccccagctagagcccagccactttctgaaa
aagctggcctcccagggaaaccctcctctgcacaaatggaagagcatggtggggttgcag
gccagtaaactgtaa

DBGET integrated database retrieval system