KEGG   Ornithorhynchus anatinus (platypus): 100082242Help
Entry
100082242         CDS       T01045                                 

Gene name
TMSB4X
Definition
(RefSeq) thymosin beta 4, X-linked
  KO
K05764  thymosin, beta 4
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100082242 (TMSB4X)
Cytoskeleton proteins [BR:oaa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     100082242 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin WH2 DUF4522
Motif
Other DBs
NCBI-GeneID: 100082242
NCBI-ProteinID: XP_007668581
UniProt: F7G1M4
Position
Un
AA seq 44 aa AA seqDB search
MSDKPDMAEIQKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaccagatatggccgagattcagaaattcgataaatccaaattgaagaag
acagaaacgcaagagaaaaacccactcccttcaaaagaaacaattgaacaggagaagcaa
gcgggtgaatcgtaa

DBGET integrated database retrieval system