KEGG   Ornithorhynchus anatinus (platypus): 100082242Help
Entry
100082242         CDS       T01045                                 

Definition
thymosin beta-4-like
Orthology
K05764  
thymosin, beta 4
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:oaa04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 44 aa AA seqDB search
MSDKPDMAEIQKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaccagatatggccgagattcagaaattcgataaatccaaattgaagaag
acagaaacgcaagagaaaaacccactcccttcaaaagaaacaattgaacaggagaagcaa
gcgggtgaatcgtaa

DBGET integrated database retrieval system