KEGG   Ornithorhynchus anatinus (platypus): 100082250Help
Entry
100082250         CDS       T01045                                 

Definition
cytochrome P450 3A29-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:oaa00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:oaa00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:oaa00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:oaa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 504 aa AA seqDB search
MSSILNFSIETWILLGTFLALMILYGIWPFRVFTKSGIPGPRPVPFFGNILEYSQGIIEF
DKKCFQKYGKIWRLFEGRQAMVAVLDLEIIKTVLVKEVFSSFTNRRRIGIEGIMEESIIG
AEDEQWKELRILISPTFSSGKLKEMLRIMIHYGEILVKTIWKKAEKNQNVIVKDYYGAYS
LDVITSTSFGVDVNSLNKMNDTYFKEVKKLSSVDFFSPLLALTSIFPFITPLLNLLDISL
FPSDSVEYIKRFVHKIRESRHQDNQQHRADLLKLLLDSQNPKEGLKGKKGLSDTGILAQA
VAFVFAGYETTSSALSFISYNLATHPDVQQKLQEEIDKVLPNKSPLTYDAIVQMEYLDMV
INETLRLYPIGPRLERMCKKTLEINGLTIHKGTCVVIPIAVLQHDPNYWTEPDEFRPERF
SKEMREKRDPYTFIPFGVGPRNCIGMRFALLNMKVAIIGLLQNFSLRTCQETQIPLELNS
MGFLTPKKPIVLQFIPRADTKSQD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcattctcaatttctccatagaaacctggatccttcttggcactttcctggct
ctgatgatactatatggcatctggccatttagagtcttcacaaaatcgggaattcctggg
ccaaggcccgttcctttctttggaaacatactggagtattctcaaggaatcattgagttt
gacaagaaatgttttcagaaatatggaaaaatatggcggctattcgaaggccggcaagcc
atggtagctgtcctggaccttgagatcattaaaacggtactggtgaaagaagtgttcagc
agctttaccaataggcggagaataggcattgaagggataatggaagaatctattatcggt
gctgaggatgaacaatggaaggaattacgcatactgatatcacccacattctccagtgga
aaactaaaagagatgttacgcataatgatccactatggggagattttagtaaaaaccatc
tggaagaaagcagaaaagaaccagaatgtgattgtcaaggattactatggggcctacagt
ctagatgtgatcaccagtacttcatttggtgtggatgttaactccttaaacaaaatgaat
gacacatattttaaggaagtcaagaagctatcatcagttgattttttttctccacttctt
gctttgacaagtatatttccatttatcacacctcttcttaatcttctagatattagtcta
ttccccagtgattctgtggaatacattaaaagatttgtgcataaaataagggaaagccgc
catcaagacaatcaacaacaccgggcagacttactgaagttgctgcttgatagccaaaac
ccaaaggagggcttgaagggcaaaaaaggtctgagtgatactgggatcctggcacaagca
gttgcctttgtttttgcgggctatgagaccaccagcagtgccctttcttttatttcttat
aatctggccacccaccctgatgtccagcagaaattgcaggaggaaatagacaaagttcta
cccaataagtcacctctcacctatgatgccatagtacagatggagtatctagacatggtt
ataaatgaaactctaaggctgtacccgattggacctcgacttgaaaggatgtgcaagaaa
accctggaaataaatggactgaccatccataaagggacatgtgttgtaatcccaattgct
gtcctacaacatgatccgaattactggacagaacctgatgagtttcgtcctgaaaggttc
agcaaagaaatgagagagaagagggatccctacactttcataccctttggcgttggcccc
aggaactgcattggaatgagatttgcactcctcaacatgaaagtggctataatcgggctg
ctgcagaacttctcgctcaggacctgccaagagacccagattcctctggagctgaattca
atgggattcttaactcccaaaaaacccattgttctgcagttcatccctagagctgatacc
aagagtcaggactga

DBGET integrated database retrieval system