KEGG   Ornithorhynchus anatinus (platypus): 100082318Help
Entry
100082318         CDS       T01045                                 

Gene name
PASD1
Definition
PAS domain containing 1
Orthology
K09026  
neuronal PAS domain-containing protein 2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Circadian rhythm
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    100082318 (PASD1)
Transcription factors [BR:oaa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100082318 (PASD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 803 aa AA seqDB search
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELCTMLQGHGHPLKMDKSTILQRTIDFLQK
QKEITAQSEACEIRQDWKPSFLSNEEFTQLMLEALDGFLIALTTDGIIIYVSDSVSSLLG
HLPSDLVDQNILNFLPEREQSEVYKLLSPHVLMTDPVAADFLNTEKQIEFCCHLARGRLD
SNEPLTYEYVKFVVEFKFFTHVPTPSCNGFESAIARAFRSATEEQICLVATVRLVTPQFL
KELCNVEEPCEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHADDLELLAR
CHEHLMQFGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHTVVSYGEVRA
EKRRDLGLEESSVELAASSLKSHSSYIDNRQCESNQDTSRERVSVSSHSSRRSSHTAMSD
SASTSSMRPTEASTPTRPLVCLGQDKTPRRLSTSSSSQAIVPPQAPAEHLTQHHLAQAAV
PSQQTLMPVYHFPAQLGMMHQLKEQLEERTRILQADIKTQQEELHVIKEQLQLVQDSNLQ
MLMQQPLPLGFNHSPSQTPRRPSRQSPGASRQPPEIAKKSHVALMGPKHYCASHLPSPRQ
FLREPCVTTAQVQQPQQVMRGSQAQQTRLPAHTSISMPLYSNPVLFSQASPITVSAQMPT
EISERQQPPEYSQDRSLRFVQDQQQMLPSLQMQPITCSTIIAPSSSSSSSSPAFTPSVMI
SHSNFPSHQTHQVQLHQWPQQPAPQHHLYLQMAAPESVHGGQTQRVFQPSHPPPQGTMSY
FLHPPQQSHSPQSLQDLPEMQLP
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagatgaaaaggacagggcaaagagggcttcacgcaacaaatccgagaagaaa
aggagagatcaattcaatgtcctcattaaggaactctgcacaatgctccagggacatggc
caccctcttaaaatggacaagtctacaatactacagaggaccattgacttcttacaaaag
caaaaagaaatcacagcccagtcagaagcatgtgaaatcagacaagactggaaaccttcg
ttccttagcaatgaagaattcacccagttgatgttagaggctttggatggatttctaatt
gcacttaccacagatggaattattatttatgtatctgatagtgtctcatctcttcttggc
catttaccgtcagatttggtggaccaaaatatattaaactttctgcctgaacgagaacag
agtgaagtttacaaacttctctctccacacgtgcttatgactgatccagttgcagctgat
tttctaaacactgaaaaacaaatagagttttgctgccatttagcgagaggaagattagat
tccaatgaaccgttgacctacgaatatgtgaaatttgtagtggaatttaaattttttact
catgtgcctacaccctcgtgtaatggttttgagtcagctattgcaagggctttcagatca
gcaacagaggaacagatttgcctggtagcaacagttcgtctggtcacaccacaattttta
aaggaactttgcaatgtagaagagccatgtgaagaatttacatcaagacacagtttggaa
tggaagtttcttttcttggaccacagggctccacctatcatcggatacttaccctttgag
gtgctgggaacatcaggatacgattattatcatgctgatgatctggagttactcgctagg
tgccatgaacatttaatgcaattcggaaaaggaaagtcctgttactataggttcttgacg
aaaggtcagcagtggatttggttgcaaactcactattacatcacttaccaccagtggaat
tccaagcctgaattcattgtttgcacacacactgttgtaagttatggagaagttcgggca
gaaaaaagacgagatctagggcttgaagaatcatcagtggagctggctgcttcttcctta
aagagtcacagtagttatatagacaaccggcaatgtgaaagcaaccaagacaccagtagg
gaaagagtgtctgtgtcatctcacagttcccgcagatcttcacatacagccatgtctgat
tctgcatctacgtcatccatgcggccaactgaagccagcactccaaccaggccattggtt
tgcctgggtcaagataagacaccccggaggctgtccaccagcagcagctcccaggctata
gtacctccacaagcacctgccgaacacctgactcaacatcatctggcccaggcagcggta
ccctcccagcaaactctaatgccagtgtaccactttcctgcccagctagggatgatgcac
cagctcaaagaacagctggaagagaggacacgtatattgcaagctgacatcaaaacgcag
caggaagagcttcatgtgataaaagaacaactccaacttgtgcaggattccaacttgcag
atgttgatgcagcagccccttcctctgggctttaaccattccccatcccagactccacgg
aggccatcccggcagagccctggagcgagcaggcagccgcccgaaatagccaagaaatcc
cacgtggcactcatggggcccaagcattactgtgcttcacacttaccctcaccacgccaa
ttcctcagggaaccctgtgtcaccaccgcccaggtacagcaaccgcagcaagtgatgcga
ggaagccaggcccagcagacccgcctaccagcccacactagcatttccatgcctctctac
agcaatcctgtgctcttttcccaggcgtctcccattactgtctctgctcagatgccgact
gagatcagtgaaaggcaacaaccccccgaatacagccaagaccgaagcttaagatttgtc
caagatcagcagcagatgctgccctcattgcagatgcagcccattacatgtagcaccatc
atcgcgccctcctcctcttcctcctcctcctctcctgccttcaccccttctgtgatgatc
tcccactccaatttcccttcccaccagacacaccaggttcaactccaccaatggccacaa
caaccagcaccacagcatcatctctacctacagatggcagctccagaatccgtccatgga
gggcagacccagcgtgttttccagccatcccaccctcccccgcagggcaccatgagctat
ttcctccaccctcctcaacaaagccattccccacagagcctgcaggacctgcctgagatg
cagctgccatga

DBGET integrated database retrieval system