KEGG   Ornithorhynchus anatinus (platypus): 100082499Help
Entry
100082499         CDS       T01045                                 

Definition
cGMP-dependent protein kinase 2-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Gap junction
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Class
Cellular Processes; Cell communication; Gap junction [PATH:oaa04540]
Organismal Systems; Digestive system; Salivary secretion [PATH:oaa04970]
Organismal Systems; Nervous system; Long-term depression [PATH:oaa04730]
Organismal Systems; Sensory system; Olfactory transduction [PATH:oaa04740]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:oaa04713]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 325 aa AA seqDB search
MASLQLTLRREKQLITDALNKNQFLKRLEPQQLRDMVECMQRRDYPEGSYILKQGEPGNH
IFVLAEGSVEVFQGNMLLTSIPEWTTFGELAILYNCTRTASVKAVTDTKTWALEREVFQN
IMRKAAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEFYDRGDFIIREGEEGNTFF
VLAKGKVKVTQSMEDHDQPQVIKVLQKGDYFGEKALISDDVRSANIIAEENGVACLVIDR
ETFNQTVGTLEELQKYLEGYVADLDRDDEKRHAKRSMGGCSLAQALSLEMIELKEKVAHF
SSSAPFQHLEIVTTLGVGGFGRVEL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcttcaattgacgctcaggagggaaaagcagctcatcacagacgccctgaac
aagaatcagtttctgaagagactggagccccagcagctgagggacatggtggagtgcatg
caaaggagagattacccagaaggcagttatattctcaagcaaggggagccgggaaaccac
atctttgtcctggcagagggcagcgtggaggtgtttcaggggaacatgctgctcacctcg
atccccgagtggacgacgtttggagaactcgccatcctgtacaactgcaccaggacggcc
tctgtgaaagctgtcaccgacacgaagacctgggccctggagagagaggttttccagaat
atcatgcgcaaggcggcccaggccagagacgaacagtacagaaacttcctcagaagcgtc
tccttgttgaagaatttacctgaagataaattaaccaagatcatagactgtttggaagtg
gaattctatgaccgaggggacttcatcatccgagagggggaggaaggaaatacctttttc
gtcttggccaaaggaaaggtgaaagtcactcagagtatggaagaccacgatcagccgcaa
gtgattaaggtgttgcagaagggcgattactttggggagaaagctctcatcagcgatgat
gtccggtcggctaacatcattgcggaagaaaatggtgtggcgtgcctggtcatagaccga
gagacattcaatcagacagtgggcaccttggaggagctccagaagtacctggaagggtat
gtagccgatctggaccgggatgacgagaaaagacacgccaagaggtccatgggaggctgt
tcgctggcccaggccctgtccctggagatgatcgagctgaaggagaaagtggctcacttc
tcctcctcggccccgttccagcacctggagatcgtcaccacactgggcgttggtgggttc
ggaagagtcgagctc

DBGET integrated database retrieval system