KEGG   Ornithorhynchus anatinus (platypus): 100082499Help
Entry
100082499         CDS       T01045                                 

Definition
(RefSeq) cGMP-dependent protein kinase 2-like
  KO
K19477  
cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Regulation of lipolysis in adipocytes
Renin secretion
Salivary secretion
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100082499
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100082499
 Organismal Systems
  Immune system
   04611 Platelet activation
    100082499
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100082499
   04924 Renin secretion
    100082499
  Digestive system
   04970 Salivary secretion
    100082499
  Nervous system
   04730 Long-term depression
    100082499
  Sensory system
   04740 Olfactory transduction
    100082499
  Environmental adaptation
   04713 Circadian entrainment
    100082499
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100082499
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100082499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 325 aa AA seqDB search
MASLQLTLRREKQLITDALNKNQFLKRLEPQQLRDMVECMQRRDYPEGSYILKQGEPGNH
IFVLAEGSVEVFQGNMLLTSIPEWTTFGELAILYNCTRTASVKAVTDTKTWALEREVFQN
IMRKAAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEFYDRGDFIIREGEEGNTFF
VLAKGKVKVTQSMEDHDQPQVIKVLQKGDYFGEKALISDDVRSANIIAEENGVACLVIDR
ETFNQTVGTLEELQKYLEGYVADLDRDDEKRHAKRSMGGCSLAQALSLEMIELKEKVAHF
SSSAPFQHLEIVTTLGVGGFGRVEL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcttcaattgacgctcaggagggaaaagcagctcatcacagacgccctgaac
aagaatcagtttctgaagagactggagccccagcagctgagggacatggtggagtgcatg
caaaggagagattacccagaaggcagttatattctcaagcaaggggagccgggaaaccac
atctttgtcctggcagagggcagcgtggaggtgtttcaggggaacatgctgctcacctcg
atccccgagtggacgacgtttggagaactcgccatcctgtacaactgcaccaggacggcc
tctgtgaaagctgtcaccgacacgaagacctgggccctggagagagaggttttccagaat
atcatgcgcaaggcggcccaggccagagacgaacagtacagaaacttcctcagaagcgtc
tccttgttgaagaatttacctgaagataaattaaccaagatcatagactgtttggaagtg
gaattctatgaccgaggggacttcatcatccgagagggggaggaaggaaatacctttttc
gtcttggccaaaggaaaggtgaaagtcactcagagtatggaagaccacgatcagccgcaa
gtgattaaggtgttgcagaagggcgattactttggggagaaagctctcatcagcgatgat
gtccggtcggctaacatcattgcggaagaaaatggtgtggcgtgcctggtcatagaccga
gagacattcaatcagacagtgggcaccttggaggagctccagaagtacctggaagggtat
gtagccgatctggaccgggatgacgagaaaagacacgccaagaggtccatgggaggctgt
tcgctggcccaggccctgtccctggagatgatcgagctgaaggagaaagtggctcacttc
tcctcctcggccccgttccagcacctggagatcgtcaccacactgggcgttggtgggttc
ggaagagtcgagctc

DBGET integrated database retrieval system