KEGG   Ornithorhynchus anatinus (platypus): 100082499Help
Entry
100082499         CDS       T01045                                 

Definition
cGMP-dependent protein kinase 2-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100082499
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100082499
 Organismal Systems
  Immune system
   04611 Platelet activation
    100082499
  Digestive system
   04970 Salivary secretion
    100082499
  Nervous system
   04730 Long-term depression
    100082499
  Sensory system
   04740 Olfactory transduction
    100082499
  Environmental adaptation
   04713 Circadian entrainment
    100082499
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100082499
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100082499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 325 aa AA seqDB search
MASLQLTLRREKQLITDALNKNQFLKRLEPQQLRDMVECMQRRDYPEGSYILKQGEPGNH
IFVLAEGSVEVFQGNMLLTSIPEWTTFGELAILYNCTRTASVKAVTDTKTWALEREVFQN
IMRKAAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEFYDRGDFIIREGEEGNTFF
VLAKGKVKVTQSMEDHDQPQVIKVLQKGDYFGEKALISDDVRSANIIAEENGVACLVIDR
ETFNQTVGTLEELQKYLEGYVADLDRDDEKRHAKRSMGGCSLAQALSLEMIELKEKVAHF
SSSAPFQHLEIVTTLGVGGFGRVEL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcttcaattgacgctcaggagggaaaagcagctcatcacagacgccctgaac
aagaatcagtttctgaagagactggagccccagcagctgagggacatggtggagtgcatg
caaaggagagattacccagaaggcagttatattctcaagcaaggggagccgggaaaccac
atctttgtcctggcagagggcagcgtggaggtgtttcaggggaacatgctgctcacctcg
atccccgagtggacgacgtttggagaactcgccatcctgtacaactgcaccaggacggcc
tctgtgaaagctgtcaccgacacgaagacctgggccctggagagagaggttttccagaat
atcatgcgcaaggcggcccaggccagagacgaacagtacagaaacttcctcagaagcgtc
tccttgttgaagaatttacctgaagataaattaaccaagatcatagactgtttggaagtg
gaattctatgaccgaggggacttcatcatccgagagggggaggaaggaaatacctttttc
gtcttggccaaaggaaaggtgaaagtcactcagagtatggaagaccacgatcagccgcaa
gtgattaaggtgttgcagaagggcgattactttggggagaaagctctcatcagcgatgat
gtccggtcggctaacatcattgcggaagaaaatggtgtggcgtgcctggtcatagaccga
gagacattcaatcagacagtgggcaccttggaggagctccagaagtacctggaagggtat
gtagccgatctggaccgggatgacgagaaaagacacgccaagaggtccatgggaggctgt
tcgctggcccaggccctgtccctggagatgatcgagctgaaggagaaagtggctcacttc
tcctcctcggccccgttccagcacctggagatcgtcaccacactgggcgttggtgggttc
ggaagagtcgagctc

DBGET integrated database retrieval system