KEGG   Ornithorhynchus anatinus (platypus): 100082550Help
Entry
100082550         CDS       T01045                                 

Definition
ubiquitin carboxyl-terminal hydrolase 38-like
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1104 aa AA seqDB search
MADFQEHTKFLSPAPRSQLGLVAPVASSEIDGYFSSSSAVATVADAITSAAFFANITEGF
SSNHPCLRHHLLWVLVLELPSAAGRNLDASLTLSVSLVLTCFDSVLSSTWPRLGILSAAI
FNLSSNSSHVCAMRGLLCLRHGVPEPHVGSRKAADTKGWTGLARSSTSPCLARALMAPQF
SLSREPPTEMRGSKLEIPRKLTSRRFAPVPQGYSVVLRKQVSGILSSQVPQFGAELQIST
AYQTVHVCIGVFFCLSSSLISLLPPTTKPVIPSHEFRMVHAPQARRVGELRFDTSYEPSV
ALASLVQHIPLQMITVLIRSLTTDPNVKDASTTQALCRMIDWLSWPLAQHVETWVIALLK
GLAAVQKFTILIDVTLLKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLIVPHV
VTLLRSFKSDGLPSSTAFLVQLTELIHCMMYHYSGFPDLYEPILEAIKDLPKPSEEKIKL
ILNQSAWTSQSNSLASCLSRLSGKSETGKTGLINLGNTCYMNSVIQALFMATDFRRHVLS
LNLNGCNSLMKKLQHLFAFLAHTQREAYAPRIFFEASRPPWFAPRSQQDCSEYLRFLLDR
LHEEERTLKALSSLKPPENPGSEEMTSQEVANQTPPFAEISYTKDGEKTLIEKMFGGKLQ
TNICCLNCRSTSQKEEAFTDLSLAFCPSPAAENVSSQGSARSPGVQAGVESAVLPEEPAP
CHPLTAGFGYETAMNEGTLDDIPSELHRTDENTSASEDPYRFQSNREASQKPGGEMTPSV
TDLLNYYLAPEILNGDNRYYCENCASLQNAEKTMQIMEEPEYLILTLLRFSYDQKCHVRR
KILDNVSLPLVLELPVKRTTSSLTSVSGSWAVDVDLPDVSENLAKKLKPSGVEEACCPQS
MPYLLSSVVVHSGISSESGHYYSYARNITGSEPSFQLCHQSETLALAPPQGHLFGGEVPK
QVAEQDLGDKDGSKEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLLYKKQNSTSGFNA
SSSNGLWVNGDPPLQKELMDAITKDNKLYLQEQELNARTRALQAASASCSFRPNGFDDND
PPGSCGPTGGGGGGGFSTIGRLVF
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atggcagacttccaagagcacacgaaattcctatcgccagccccgaggagccaactaggg
cttgtggctcctgttgcctccagtgaaatagatggttatttctcctcttcttcagcggtg
gccacggtagccgatgccatcacttctgctgccttcttcgccaacataaccgaggggttc
tcttccaaccacccctgcttaaggcatcatctattatgggtcctggtgcttgagctgccg
agcgctgccggcagaaatctagacgctagcctgaccttgtccgtttccttggtcctcacc
tgcttcgactctgtcctgtcgtccacctggccacgtttaggaattttgagcgctgccatc
tttaacctgtcttcgaatagttctcacgtatgtgcgatgcgtggccttctttgtttgagg
cacggcgtaccagagccgcacgtgggttcaagaaaggccgcagacaccaagggctggacc
ggattggcacgcagctcgacttcgccatgcttggcccgggctctaatggcccctcagttc
tccctcagtcgagagcctccaacagaaatgcgtggtagcaaactggaaataccacggaaa
ctcacctctaggcggtttgccccggtgccccagggctactccgtggtcctccggaaacaa
gtttcaggcatcctctccagtcaggtaccgcagtttggtgccgagctccagatttctact
gcgtaccaaactgtacacgtgtgcatcggtgtcttcttctgtctttcctcttccctgatc
tctcttcttcctcccaccacaaaaccagtcattccttctcatgagtttaggatggtacac
gcgccacaggccagaagggttggggaactccgttttgatacttcatatgaaccttctgtt
gccctggcaagcctggtgcagcacattcccctgcagatgattacggttctcatcaggagc
cttaccacagatccaaatgtaaaagatgcaagtacgactcaagctctgtgcagaatgatt
gactggctctcttggcccttggcgcaacatgtggagacatgggtgattgcactactaaaa
ggcctggcagcagtccaaaagtttactattctgatagatgtcacgttgctgaaaatcgaa
ctggtttttaatcgactttggtttcctctcgtgagacctggtgctcttgccgttctttcc
cacatgttgcttagttttcagcattctccagaggctttccacttgatcgttcctcatgtg
gtcaccttgcttcgctctttcaaaagtgatggcctaccttccagtactgccttcttagtg
cagttgacagaattaattcattgtatgatgtatcactattcaggatttccagatctgtac
gagcctattctggaggctattaaggatcttcccaaacccagtgaagaaaagattaaattg
atcctcaatcaaagtgcctggacttctcaatcaaattctttggcatcttgtttgtctaga
ctttctggaaaatctgaaactgggaaaactggtctgattaacctaggaaatacatgttat
atgaacagtgtaattcaggcattgtttatggccacagatttcaggagacatgtattatcc
ttaaatctaaatgggtgcaattcattaatgaaaaaattgcaacatctttttgcctttttg
gcacatacccagagggaggcgtatgcccctcggattttctttgaggcttccagacctccc
tggtttgctcctcgatcccagcaggactgctctgaatatctcagatttctcctagacaga
ctccacgaagaagagagaaccttgaaagccctgtcttcacttaagcctcctgaaaatcca
gggtctgaagagatgacatctcaagaggtagccaaccagaccccaccatttgcagagatc
tcttatacgaaggacggagagaaaacattaatagagaaaatgtttggagggaagctgcaa
actaacatctgctgtttgaactgcagaagtacttcacagaaagaggaggccttcacagat
ctctctctagcgttttgtccctcccccgccgcagaaaacgtttcctcgcaaggttcggcc
cgttctccaggggtgcaagccggtgtagagtcagctgtacttcctgaagaaccagcaccc
tgtcatcctctcacggcgggctttggctatgaaacggctatgaacgaaggaacgttagac
gatatcccctcggaacttcaccgtactgacgaaaacacttccgcctctgaagatccctac
agatttcagagtaatagagaggcatctcagaaaccgggaggtgaaatgactccctcagtt
accgatttgctaaattattatctggcaccagaaatcctgaatggggataaccgatactat
tgtgaaaactgtgcctctctgcagaatgcagagaaaactatgcaaatcatggaggagcct
gaatatttaattctcactctcctgcgattctcatatgatcagaaatgccacgtaagacgc
aaaatcctagacaacgtgtcactgccgctggttttggaattaccggtcaaacgaactact
tcctctttaacttccgtgtccggaagttgggccgtagatgtggatctccctgacgtgagt
gagaacctagctaaaaaactgaagccctctggggttgaagaagcatgctgcccgcaatcg
atgccctatttgttaagctctgttgttgttcactctggcatatcatctgaaagcggacat
tattattcctatgccagaaacatcacaggttcagaaccttcctttcaattgtgccatcag
tctgaaactctggctttagctccccctcagggtcatttgtttgggggagaggttcccaag
caagttgccgaacaggacctgggcgacaaggacgggtcgaaagagtggtttttatttaat
gacagcagagtgacatttacctcatttcagtcggtccagaaaattaccagtagatttcca
aaggacaccgcttatgtcctgctgtacaagaaacagaatagcactagtggtttcaatgct
agctcatccaacggactctgggtaaatggagatccccctctgcagaaggagcttatggat
gctatcacgaaagataataaactgtatttgcaggaacaagagctgaatgcccgaacccgg
gccctccaagctgcttctgcctcttgttcatttcgccccaatggatttgatgacaacgac
cccccaggcagctgtggaccgacgggtggaggaggtggggggggattcagtactatcggc
aggctagttttttaa

DBGET integrated database retrieval system