KEGG   Ornithorhynchus anatinus (platypus): 100082582Help
Entry
100082582         CDS       T01045                                 

Gene name
GAB1
Definition
(RefSeq) GRB2 associated binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa04012  ErbB signaling pathway
oaa04014  Ras signaling pathway
oaa04072  Phospholipase D signaling pathway
oaa04722  Neurotrophin signaling pathway
oaa05100  Bacterial invasion of epithelial cells
oaa05205  Proteoglycans in cancer
oaa05211  Renal cell carcinoma
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100082582 (GAB1)
   04012 ErbB signaling pathway
    100082582 (GAB1)
   04072 Phospholipase D signaling pathway
    100082582 (GAB1)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    100082582 (GAB1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100082582 (GAB1)
   05225 Hepatocellular carcinoma
    100082582 (GAB1)
   05226 Gastric cancer
    100082582 (GAB1)
   05211 Renal cell carcinoma
    100082582 (GAB1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100082582 (GAB1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100082582 (GAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11 PH_8 PH_13 PH_3 PH_9
Motif
Other DBs
NCBI-GeneID: 100082582
NCBI-ProteinID: XP_007666636
Position
Un
AA seq 835 aa AA seqDB search
MAFLSQPEMASYNVMEGKTIPACCLGCNAGVMSFQNFALKKISQSVEKMPVVKCGSQWFL
PMFLNTQRQSPRSCMRGLYLDDIVDSLFQNVININGQDSAWICRKHREAWKRRWFVLRSG
RLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYL
VADSEEEMNKWVRCICDICGFNPTEEDPVKPPGALPASAELPLAINTSPPSMQAESSLGS
LPPPYQLINLPPHLEALSIQDDPQDYLLLINCQSKKPEPASQGSSFVSEEGEEYLLLEDF
ESKKMPLQPHAESAKSTSSETDCNDNVPSHKNPGSSQGKHAVNGFFQQPSMYDSPPSRAA
SVSIDSSLYNLPRSYSHDVLPKAASPSSTEADGELYVFNTPSGASSVESQMRHVSLSYDI
PPTPGGTYQIPRTFPDGTLGQTSKLETIPDIPPPRPPKPHPAHDRSPVETCTITRTASDT
DNSYCIPTAGVPPSRSNTISTVDLNRLRKDATSQDCYDIPRTFPSDRSSSLEGFHNHFKN
KSMLTVGSLSSEELDENYVPMNPNSPSRQHSSSLTEPIQEANYVPMTPGTFDFSSFGMQV
PPPAHMGFRSSPKTPPRRPVPGVDCEPPPVDRNLKPDRKGQSPKILRPKPHGLERTDSQT
IGDFATRRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSS
SDSHDSEENYVPMNPNLSSEDSNLFGSSSLDGGSSPMVKPKGDKQVEYLDLDLDSGKSTP
PRKKKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPTKSVK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggcctttctctcacaaccagaaatggcttcttataacgttatggaaggcaagactatc
ccggcctgctgccttggttgtaatgctggggttatgtccttccagaactttgcgttaaag
aaaatcagtcaatcagtggaaaaaatgcctgtggtgaagtgtgggagccagtggttcctg
ccgatgtttctgaacacccagagacagtccccgaggagctgcatgagaggtttatattta
gatgacattgtggattctctatttcaaaatgtcataaacataaatgggcaagacagtgct
tggatttgtcgaaaacacagagaggcatggaagagaagatggttcgtgctgcggagtggc
cgtttaacaggagatccggatgtcttggaatactataaaaatgaccatgccaaaaaacct
atccgtatcattgacttaaatttatgccagcaagtagatgctggattgacatttaacaaa
aaggagtttgaaaatagctacatttttgacatcaacactatagaccgcatcttctacttg
gtggcagacagcgaagaggagatgaataagtgggttcgatgtatctgtgacatctgtggg
tttaacccaacagaggaagatcctgtgaaaccccctggagccttgccagcatctgctgag
ttgcctttagctatcaatacttcacccccatctatgcaggcagagtcatccttaggctct
ctacctcctccttatcaactaattaatctaccaccacatctggaggctctttccattcaa
gatgatccccaagactacctgttgctaatcaactgtcaaagcaagaagcctgaacctgca
agccaaggttcatcttttgtctctgaagaaggggaggaatatctactcctagaagatttt
gaaagcaaaaagatgccactgcaaccccatgctgagtctgcgaaatccacctcctccgaa
acagactgcaatgacaacgtcccgtctcacaaaaatccaggttcctcccagggcaaacac
gcggtgaatggctttttccagcagccaagcatgtacgactccccgccctcccgcgccgca
tccgtttctatagactccagcctttataacctgccgaggagttactcccacgatgttttg
ccaaaagcagcttctccatcgagcaccgaggcggacggagaactctatgtttttaatacc
ccatctggagcatcatcagtagagagtcaaatgaggcacgtctctctgagctatgacatt
cccccaacgcccggaggtacttaccagattccacgaacttttccagacggaaccttggga
cagacgtccaagctagagactattccggatatacctccaccccggcctccgaaaccccac
ccagctcacgatcgatcccctgtggaaacgtgtaccataacccgcactgcctcagacact
gacaatagttactgcatccctacagcgggggtgccgccatcgcgtagtaataccatttcc
actgtggatttgaacagattgcgaaaagatgctacttctcaagactgttatgatattccc
cgaacatttccaagcgatagatctagctcacttgaaggcttccataaccactttaaaaac
aaaagcatgttgacagtgggaagtttgtcaagtgaagaactagatgaaaactatgtcccg
atgaatcccaactcaccatcacgacagcattccagcagtctcactgagccaatccaggaa
gcaaactatgtaccaatgacaccaggcacgtttgatttttcgtcctttggaatgcaagtc
cctcctcctgctcacatgggcttcaggtcaagtccaaagacccctcccagaaggccagtt
cctggagtagactgtgagcctccaccagtggataggaacctcaagccagacagaaaaggt
caaagtcctaaaattttaagacctaaaccacatggtttagagagaactgactcacaaacc
ataggtgactttgccacaagaagaaaggtaaagccagcgccacttgaaataaaaccttta
cctgaatgggaagaacttcaagccccagtccgatctcctattactagaagctttgcccga
gactcctccaggtttcctatgtctcccagaccggattcagttcatagcacaacttcaagc
agtgactcgcacgacagtgaagagaattatgtacccatgaatccaaatctatccagtgaa
gactcaaatctgtttggcagcagtagtcttgatggaggaagcagccctatggtaaagcct
aaaggagataagcaagtggaatatttagatctagatttagattctggaaaatccacacca
cctcgtaagaagaagagcagtggctccggtagcagtgtggcagatgaaagagtagattat
gtcgtagttgaccaacagaagacgctggccctgaagagcacccgagaagcatggaccgat
gggagacagagtacggaatctgaaacacccactaagagtgtcaaatga

DBGET integrated database retrieval system