KEGG   Ornithorhynchus anatinus (platypus): 100082582Help
Entry
100082582         CDS       T01045                                 

Definition
GRB2-associated-binding protein 1-like
Orthology
K09593  
GRB2-associated-binding protein 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
ErbB signaling pathway
Ras signaling pathway
Neurotrophin signaling pathway
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:oaa04014]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:oaa04012]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:oaa04722]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:oaa05205]
Human Diseases; Cancers; Renal cell carcinoma [PATH:oaa05211]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:oaa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 902 aa AA seqDB search
MAFLSQPEMASYNVMEGKTIPACCLGCNAGVMSFQNFALKKISQSVEKMPVVKCGSQWFL
PMFLNTQRQSPRSCMRGLYLDDIVDSLFQNVINMFNEWHIFLEEYFVQVKTNFVPQCLGA
ESLWPNVIQPLFPSEEEAEKGLVCRTLILLGERENTGPGLFRNIQVLGAEALLQKSFLVD
PKLTHYRRIHGILHTTSTLATVAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDL
NLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEE
DPVKPPGALPASAELPLAINTSPPSMQAESSLGSLPPPYQLINLPPHLEALSIQDDPQDY
LLLINCQSKKPEPARPHAESAKSTSSETDCNDNVPSHKNPGSSQGKHAVNGFFQQPSMYD
SPPSRAASVSIDSSLYNLPRSYSHDVLPKAASPSSTEADGELYVFNTPSGASSVESQMRH
VSLSYDIPPTPGGTYQIPRTFPDGTLGQTSKLETIPDIPPPRPPKPHPAHDRSPVETCTI
TRTASDTDNSYCIPTAGVPPSRSNTISTVDLNRLRKDATSQDCYDIPRTFPSDRSSSLEG
FHNHFKNKSMLTVGSLSSEELDENYVPMNPNSPSRQHSSSLTEPIQEANYVPMTPGTFDF
SSFGMQVPPPAHMGFRSSPKTPPRRPVPGVDCEPPPVDRNLKPDRKGQSPKILRPKPHGL
ERTDSQTIGDFATRRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRPDS
VHSTTSSSDSHDSEENYVPMNPNLSSEDSNLFGSSSLDGGSSPMVKPKGDKQVEYLDLDL
DSGKSTPPRKKKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPTKS
VK
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atggcctttctctcacaaccagaaatggcttcttataacgttatggaaggcaagactatc
ccggcctgctgccttggttgtaatgctggggttatgtccttccagaactttgcgttaaag
aaaatcagtcaatcagtggaaaaaatgcctgtggtgaagtgtgggagccagtggttcctg
ccgatgtttctgaacacccagagacagtccccgaggagctgcatgagaggtttatattta
gatgacattgtggattctctatttcaaaatgtcataaacatgtttaatgaatggcatatc
tttttggaagagtactttgtccaagtaaagacaaactttgtgccacagtgtctgggagct
gaaagtctctggcctaatgtgattcagcccctgtttccatctgaagaggaagcagaaaag
ggccttgtttgccggaccctaattctcctgggggagagagagaacacgggtcctggttta
ttcaggaatattcaggttcttggtgctgaggctctgctgcagaagagtttcttagtcgat
ccaaaacttacacactaccgtaggatacatggtatcctacacactacctctacactggcc
acagtggcatggaagagaagatggttcgtgctgcggagtggccgtttaacaggagatccg
gatgtcttggaatactataaaaatgaccatgccaaaaaacctatccgtatcattgactta
aatttatgccagcaagtagatgctggattgacatttaacaaaaaggagtttgaaaatagc
tacatttttgacatcaacactatagaccgcatcttctacttggtggcagacagcgaagag
gagatgaataagtgggttcgatgtatctgtgacatctgtgggtttaacccaacagaggaa
gatcctgtgaaaccccctggagccttgccagcatctgctgagttgcctttagctatcaat
acttcacccccatctatgcaggcagagtcatccttaggctctctacctcctccttatcaa
ctaattaatctaccaccacatctggaggctctttccattcaagatgatccccaagactac
ctgttgctaatcaactgtcaaagcaagaagcctgaacctgcaagaccccatgctgagtct
gcgaaatccacctcctccgaaacagactgcaatgacaacgtcccgtctcacaaaaatcca
ggttcctcccagggcaaacacgcggtgaatggctttttccagcagccaagcatgtacgac
tccccgccctcccgcgccgcatccgtttctatagactccagcctttataacctgccgagg
agttactcccacgatgttttgccaaaagcagcttctccatcgagcaccgaggcggacgga
gaactctatgtttttaataccccatctggagcatcatcagtagagagtcaaatgaggcac
gtctctctgagctatgacattcccccaacgcccggaggtacttaccagattccacgaact
tttccagacggaaccttgggacagacgtccaagctagagactattccggatatacctcca
ccccggcctccgaaaccccacccagctcacgatcgatcccctgtggaaacgtgtaccata
acccgcactgcctcagacactgacaatagttactgcatccctacagcgggggtgccgcca
tcgcgtagtaataccatttccactgtggatttgaacagattgcgaaaagatgctacttct
caagactgttatgatattccccgaacatttccaagcgatagatctagctcacttgaaggc
ttccataaccactttaaaaacaaaagcatgttgacagtgggaagtttgtcaagtgaagaa
ctagatgaaaactatgtcccgatgaatcccaactcaccatcacgacagcattccagcagt
ctcactgagccaatccaggaagcaaactatgtaccaatgacaccaggcacgtttgatttt
tcgtcctttggaatgcaagtccctcctcctgctcacatgggcttcaggtcaagtccaaag
acccctcccagaaggccagttcctggagtagactgtgagcctccaccagtggataggaac
ctcaagccagacagaaaaggtcaaagtcctaaaattttaagacctaaaccacatggttta
gagagaactgactcacaaaccataggtgactttgccacaagaagaaaggtaaagccagcg
ccacttgaaataaaacctttacctgaatgggaagaacttcaagccccagtccgatctcct
attactagaagctttgcccgagactcctccaggtttcctatgtctcccagaccggattca
gttcatagcacaacttcaagcagtgactcgcacgacagtgaagagaattatgtacccatg
aatccaaatctatccagtgaagactcaaatctgtttggcagcagtagtcttgatggagga
agcagccctatggtaaagcctaaaggagataagcaagtggaatatttagatctagattta
gattctggaaaatccacaccacctcgtaagaagaagagcagtggctccggtagcagtgtg
gcagatgaaagagtagattatgtcgtagttgaccaacagaagacgctggccctgaagagc
acccgagaagcatggaccgatgggagacagagtacggaatctgaaacacccactaagagt
gtcaaatga

DBGET integrated database retrieval system