KEGG   Ornithorhynchus anatinus (platypus): 100082582Help
Entry
100082582         CDS       T01045                                 

Gene name
GAB1
Definition
GRB2-associated binding protein 1
Orthology
K09593  
GRB2-associated-binding protein 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
ErbB signaling pathway
Ras signaling pathway
Neurotrophin signaling pathway
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100082582 (GAB1)
   04012 ErbB signaling pathway
    100082582 (GAB1)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    100082582 (GAB1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100082582 (GAB1)
   05211 Renal cell carcinoma
    100082582 (GAB1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100082582 (GAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 835 aa AA seqDB search
MAFLSQPEMASYNVMEGKTIPACCLGCNAGVMSFQNFALKKISQSVEKMPVVKCGSQWFL
PMFLNTQRQSPRSCMRGLYLDDIVDSLFQNVININGQDSAWICRKHREAWKRRWFVLRSG
RLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYL
VADSEEEMNKWVRCICDICGFNPTEEDPVKPPGALPASAELPLAINTSPPSMQAESSLGS
LPPPYQLINLPPHLEALSIQDDPQDYLLLINCQSKKPEPASQGSSFVSEEGEEYLLLEDF
ESKKMPLQPHAESAKSTSSETDCNDNVPSHKNPGSSQGKHAVNGFFQQPSMYDSPPSRAA
SVSIDSSLYNLPRSYSHDVLPKAASPSSTEADGELYVFNTPSGASSVESQMRHVSLSYDI
PPTPGGTYQIPRTFPDGTLGQTSKLETIPDIPPPRPPKPHPAHDRSPVETCTITRTASDT
DNSYCIPTAGVPPSRSNTISTVDLNRLRKDATSQDCYDIPRTFPSDRSSSLEGFHNHFKN
KSMLTVGSLSSEELDENYVPMNPNSPSRQHSSSLTEPIQEANYVPMTPGTFDFSSFGMQV
PPPAHMGFRSSPKTPPRRPVPGVDCEPPPVDRNLKPDRKGQSPKILRPKPHGLERTDSQT
IGDFATRRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSS
SDSHDSEENYVPMNPNLSSEDSNLFGSSSLDGGSSPMVKPKGDKQVEYLDLDLDSGKSTP
PRKKKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPTKSVK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggcctttctctcacaaccagaaatggcttcttataacgttatggaaggcaagactatc
ccggcctgctgccttggttgtaatgctggggttatgtccttccagaactttgcgttaaag
aaaatcagtcaatcagtggaaaaaatgcctgtggtgaagtgtgggagccagtggttcctg
ccgatgtttctgaacacccagagacagtccccgaggagctgcatgagaggtttatattta
gatgacattgtggattctctatttcaaaatgtcataaacataaatgggcaagacagtgct
tggatttgtcgaaaacacagagaggcatggaagagaagatggttcgtgctgcggagtggc
cgtttaacaggagatccggatgtcttggaatactataaaaatgaccatgccaaaaaacct
atccgtatcattgacttaaatttatgccagcaagtagatgctggattgacatttaacaaa
aaggagtttgaaaatagctacatttttgacatcaacactatagaccgcatcttctacttg
gtggcagacagcgaagaggagatgaataagtgggttcgatgtatctgtgacatctgtggg
tttaacccaacagaggaagatcctgtgaaaccccctggagccttgccagcatctgctgag
ttgcctttagctatcaatacttcacccccatctatgcaggcagagtcatccttaggctct
ctacctcctccttatcaactaattaatctaccaccacatctggaggctctttccattcaa
gatgatccccaagactacctgttgctaatcaactgtcaaagcaagaagcctgaacctgca
agccaaggttcatcttttgtctctgaagaaggggaggaatatctactcctagaagatttt
gaaagcaaaaagatgccactgcaaccccatgctgagtctgcgaaatccacctcctccgaa
acagactgcaatgacaacgtcccgtctcacaaaaatccaggttcctcccagggcaaacac
gcggtgaatggctttttccagcagccaagcatgtacgactccccgccctcccgcgccgca
tccgtttctatagactccagcctttataacctgccgaggagttactcccacgatgttttg
ccaaaagcagcttctccatcgagcaccgaggcggacggagaactctatgtttttaatacc
ccatctggagcatcatcagtagagagtcaaatgaggcacgtctctctgagctatgacatt
cccccaacgcccggaggtacttaccagattccacgaacttttccagacggaaccttggga
cagacgtccaagctagagactattccggatatacctccaccccggcctccgaaaccccac
ccagctcacgatcgatcccctgtggaaacgtgtaccataacccgcactgcctcagacact
gacaatagttactgcatccctacagcgggggtgccgccatcgcgtagtaataccatttcc
actgtggatttgaacagattgcgaaaagatgctacttctcaagactgttatgatattccc
cgaacatttccaagcgatagatctagctcacttgaaggcttccataaccactttaaaaac
aaaagcatgttgacagtgggaagtttgtcaagtgaagaactagatgaaaactatgtcccg
atgaatcccaactcaccatcacgacagcattccagcagtctcactgagccaatccaggaa
gcaaactatgtaccaatgacaccaggcacgtttgatttttcgtcctttggaatgcaagtc
cctcctcctgctcacatgggcttcaggtcaagtccaaagacccctcccagaaggccagtt
cctggagtagactgtgagcctccaccagtggataggaacctcaagccagacagaaaaggt
caaagtcctaaaattttaagacctaaaccacatggtttagagagaactgactcacaaacc
ataggtgactttgccacaagaagaaaggtaaagccagcgccacttgaaataaaaccttta
cctgaatgggaagaacttcaagccccagtccgatctcctattactagaagctttgcccga
gactcctccaggtttcctatgtctcccagaccggattcagttcatagcacaacttcaagc
agtgactcgcacgacagtgaagagaattatgtacccatgaatccaaatctatccagtgaa
gactcaaatctgtttggcagcagtagtcttgatggaggaagcagccctatggtaaagcct
aaaggagataagcaagtggaatatttagatctagatttagattctggaaaatccacacca
cctcgtaagaagaagagcagtggctccggtagcagtgtggcagatgaaagagtagattat
gtcgtagttgaccaacagaagacgctggccctgaagagcacccgagaagcatggaccgat
gggagacagagtacggaatctgaaacacccactaagagtgtcaaatga

DBGET integrated database retrieval system