KEGG   Ornithorhynchus anatinus (platypus): 100082604Help
Entry
100082604         CDS       T01045                                 

Gene name
EIF3J
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100082604 (EIF3J)
Translation factors [BR:oaa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100082604 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 203 aa AA seqDB search
EEKKETTEVKPETKVSEKKKIAEKIKEKERQQKRRQEEIKKRLEEPEEPKELTPEEQLAD
KLRLKKLQEESDLELAKETFGVTTTTVSGIDAMNPISRDDFTEFGRLLKDKITQYEKSFY
YPGFLEALVRDICISLEIDDLKKVTNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKAT
MKDDLADYGGYDGGYVQDFEDFM
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gaagagaagaaggagacgacggaggtgaagccagaaacaaaagtctcggaaaagaaaaaa
atagccgagaaaatcaaagagaaagagcggcagcagaagcggagacaagaggagatcaag
aagaggttagaagagcccgaggagcccaaggagctcacgccagaagagcagttagcagac
aagctgcggctaaagaagctccaagaggaatctgacctggaattggccaaggaaacgttt
ggtgtgaccaccaccacggtcagcggaatcgacgccatgaacccaatttccagggatgac
ttcacggagtttgggaggctgctaaaagacaaaatcacacaatacgaaaaatctttctac
taccctggttttttggaagctttagtgcgagacatttgtatttccctggaaattgacgac
ttgaaaaaagttaccaactccctgacagtgctttgcagcgagaaacagaaacaagaaaag
cagagcaaagcaaagaagaagaagaaaggcgtggtccccgggggcggactgaaggcgacc
atgaaggacgacctggcggattacggcggctacgacggcggctacgtccaagacttcgaa
gacttcatgtga

DBGET integrated database retrieval system