KEGG   Ornithorhynchus anatinus (platypus): 100082620Help
Entry
100082620         CDS       T01045                                 

Definition
chymotrypsinogen B-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 264 aa AA seqDB search
MAFLALSFFLALAAVAQGCGVPAIEPVITGHARIVNGEEAKPGSWPWQASLQDASGWHFC
GGSLINSQWVVTAAHCEVTKNDFVILGEHDRSSGEEVIQKMAVEKVFTHPDWDNYYIKND
ISLIKLASPVNFSQTVSPVCLAEAGEDYESGALVVTSGWGKTRYNALVTPNQLQQTSLPL
LSAPECKTFWGSKIDENVMVCAGAAGSSSCMGDSGGPLVQKRDGAWYLVGIVSWGSSYCS
TSTPGVYGRVTAFRDWVDQIIADN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggccttcttggctctttcttttttcctggccctcgcggccgtggctcaaggctgtggg
gttccggccattgagcctgtcatcactggccatgccaggattgtgaacggcgaagaggcg
aagcctgggtcgtggccgtggcaggcctctttgcaggatgcgagtggctggcatttctgc
ggcggttccctcatcaacagccagtgggtggtgacggcagctcactgtgaggtcacgaag
aatgatttcgtgatcctcggcgagcacgaccgaagctcgggagaggaggtgattcaaaag
atggctgtggagaaggtcttcacccacccggactgggacaactattacatcaaaaatgac
atctccctgatcaagctggcctccccagtgaatttctcccaaactgtgtcccctgtgtgc
ctggctgaagccggtgaagactacgaaagcggcgccctggtggtcaccagcggctggggc
aagacccgctacaatgccttggtgacaccaaaccagctgcagcagacctccttgcccctg
ctcagcgccccggagtgcaagacattttggggcagtaagatcgacgaaaacgtcatggtc
tgcgctggggcggctggttcctcctcttgcatgggcgactctggcggcccgttggtccag
aagcgtgatggggcatggtacctggtgggcatcgtgtcctgggggagcagctactgttcc
acttcaacccccggcgtctacggccgcgtgaccgcattccgggactgggttgaccagatc
attgccgacaactga

DBGET integrated database retrieval system