KEGG   Ornithorhynchus anatinus (platypus): 100082620Help
Entry
100082620         CDS       T01045                                 

Definition
chymotrypsinogen A-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100082620
Peptidases [BR:oaa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100082620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 264 aa AA seqDB search
MAFLALSFFLALAAVAQGCGVPAIEPVITGHARIVNGEEAKPGSWPWQASLQDASGWHFC
GGSLINSQWVVTAAHCEVTKNDFVILGEHDRSSGEEVIQKMAVEKVFTHPDWDNYYIKND
ISLIKLASPVNFSQTVSPVCLAEAGEDYESGALVVTSGWGKTRYNALVTPNQLQQTSLPL
LSAPECKTFWGSKIDENVMVCAGAAGSSSCMGDSGGPLVQKRDGAWYLVGIVSWGSSYCS
TSTPGVYGRVTAFRDWVDQIIADN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggccttcttggctctttcttttttcctggccctcgcggccgtggctcaaggctgtggg
gttccggccattgagcctgtcatcactggccatgccaggattgtgaacggcgaagaggcg
aagcctgggtcgtggccgtggcaggcctctttgcaggatgcgagtggctggcatttctgc
ggcggttccctcatcaacagccagtgggtggtgacggcagctcactgtgaggtcacgaag
aatgatttcgtgatcctcggcgagcacgaccgaagctcgggagaggaggtgattcaaaag
atggctgtggagaaggtcttcacccacccggactgggacaactattacatcaaaaatgac
atctccctgatcaagctggcctccccagtgaatttctcccaaactgtgtcccctgtgtgc
ctggctgaagccggtgaagactacgaaagcggcgccctggtggtcaccagcggctggggc
aagacccgctacaatgccttggtgacaccaaaccagctgcagcagacctccttgcccctg
ctcagcgccccggagtgcaagacattttggggcagtaagatcgacgaaaacgtcatggtc
tgcgctggggcggctggttcctcctcttgcatgggcgactctggcggcccgttggtccag
aagcgtgatggggcatggtacctggtgggcatcgtgtcctgggggagcagctactgttcc
acttcaacccccggcgtctacggccgcgtgaccgcattccgggactgggttgaccagatc
attgccgacaactga

DBGET integrated database retrieval system