KEGG   Ornithorhynchus anatinus (platypus): 100082898Help
Entry
100082898         CDS       T01045                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2-like
  KO
K03259  translation initiation factor 4E
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa03013  RNA transport
oaa04066  HIF-1 signaling pathway
oaa04150  mTOR signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04211  Longevity regulating pathway
oaa04910  Insulin signaling pathway
Module
oaa_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100082898
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100082898
   04151 PI3K-Akt signaling pathway
    100082898
   04150 mTOR signaling pathway
    100082898
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100082898
  Aging
   04211 Longevity regulating pathway - mammal
    100082898
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100082898
Messenger RNA biogenesis [BR:oaa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100082898
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100082898
Translation factors [BR:oaa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100082898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E Stm1_N DUF2080
Motif
Other DBs
NCBI-GeneID: 100082898
NCBI-ProteinID: XP_001513523
Position
Un
AA seq 104 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQTSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVSTLPSSYLSAQGP
NT seq 311 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgccttgaaagatgacgacagtggggaccatgaccagaacgaa
gaaaacagcacacagaaagacggtgagaaggaaaaaactgagcgagataaaagccagacc
agcagcaagaggaaggctgttgtccccggacccgcggaacatcccttgcagtacaactat
accttctggtactccagacgaacacccggacggcccaccagctcgcagagttacgaacag
aacatcaaacagattggcacatttgcttctgtgagtaccctgccgtcatcttaccttagc
gcacagggccc

DBGET integrated database retrieval system