KEGG   Ornithorhynchus anatinus (platypus): 100082898Help
Entry
100082898         CDS       T01045                                 

Definition
eukaryotic translation initiation factor 4E type 2-like
Orthology
K03259  
translation initiation factor 4E
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:oaa03013]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:oaa04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:oaa04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:oaa04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:oaa04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 90 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQTSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFAS
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgccttgaaagatgacgacagtggggaccatgaccagaacgaa
gaaaacagcacacagaaagacggtgagaaggaaaaaactgagcgagataaaagccagacc
agcagcaagaggaaggctgttgtccccggacccgcggaacatcccttgcagtacaactat
accttctggtactccagacgaacacccggacggcccaccagctcgcagagttacgaacag
aacatcaaacagattggcacatttgcttct

DBGET integrated database retrieval system