KEGG   Ornithorhynchus anatinus (platypus): 100082898Help
Entry
100082898         CDS       T01045                                 

Definition
eukaryotic translation initiation factor 4E type 2-like
Orthology
K03259  
translation initiation factor 4E
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100082898
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100082898
   04151 PI3K-Akt signaling pathway
    100082898
   04150 mTOR signaling pathway
    100082898
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100082898
Translation factors [BR:oaa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100082898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 104 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQTSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVSTLPSSYLSAQGP
NT seq 311 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgccttgaaagatgacgacagtggggaccatgaccagaacgaa
gaaaacagcacacagaaagacggtgagaaggaaaaaactgagcgagataaaagccagacc
agcagcaagaggaaggctgttgtccccggacccgcggaacatcccttgcagtacaactat
accttctggtactccagacgaacacccggacggcccaccagctcgcagagttacgaacag
aacatcaaacagattggcacatttgcttctgtgagtaccctgccgtcatcttaccttagc
gcacagggccc

DBGET integrated database retrieval system