KEGG   Ornithorhynchus anatinus (platypus): 100082955Help
Entry
100082955         CDS       T01045                                 

Gene name
EIF3B
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100082955 (EIF3B)
Translation factors [BR:oaa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100082955 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 675 aa AA seqDB search
MAILRHSRVFEVAQNALDHTLQLVGLNQLLGDVLKDRPQEADGIDSVIVVDNVPQVGPDR
LEKLKNVIHKIFSMFGKITNDYYPEEDGKTKGYIFLEYVSPAHALDAVKNADGYKLDKQH
TFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIF
WNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLI
DFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGQKKRGFHCESSAHWPIFKWSHDGKFFA
RMTVDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLP
TRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVV
EMKESIIAFAWEPNGSKFAVLHGETPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQ
GQFVVLAGLRSMNGALAFVDTSDCTMMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDN
AYWLWTFQGRLLQKNNKDRFCQLLWRPRPTTLLSQDQIKQIKKDLKRYSKIFEQKDRLSQ
SKASKELVERRRTMMEDFRKYRKMAQELYLEQKNERLELRGGVDTDELDSNVDDWEEETI
EFFVTEEIIPLGNQE
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggccatacttaggcattcgagagtctttgaagttgctcagaatgctctggaccatact
ctgcaacttgttggcctgaatcaattactgggtgatgtgctgaaagacaggccgcaagaa
gcagacggaattgattcagtgattgtagtggacaatgtacctcaggtgggacctgatcgt
cttgagaaactgaagaatgtcatccacaagattttctccatgtttggaaaaattacaaat
gattattacccggaagaggatgggaagacaaaggggtatatttttctggagtacgtctct
cccgctcatgccctagatgctgtgaaaaatgctgatggctacaagttggacaagcagcat
accttcagagtcaaccttttcactgattttgataagtacatgacaattagcgatgagtgg
gacattccggagaaacagcccttcaaagatttgggaaatctgcggtattggcttgaggag
gcagaatgtagagatcaatatagtgtgatctttgaatctggagatcgcacttccattttc
tggaatgatgtgaaggatccagtctccattgaagaaagagcaagatggactgagacctat
gtgcgctggtctcccaaaggtacctacctagcaaccttccatcaaagaggtattgcccta
tggggaggagaaaagttcaaacagattcagaggttcagtcaccagggggtgcaacttatt
gacttctcaccctgtgaaaggtatcttgtgaccttcagccccctaatggacacccaggat
gaccctcaggccatcatcatctgggacatcctaactggacagaagaaacgaggatttcac
tgtgaaagttctgcccattggcccatttttaagtggagccatgatggaaagttctttgcc
cggatgacagtagacaccttgagcatttatgaaactccttctatgggtcttttggacaag
aagagtttgaaaatctccgggataaaagacttttcttggtcacctggtggtaacataatt
gctttttgggtgccagaagataaggacatcccagccagagtgaccttaatgcagcttccc
accagacaagaaatcagagtgcgaaatctgttcaatgttgtggactgcaaattacattgg
caaaagaatggagattatctttgcgtcaaagtagacaggactccaaaaggcacccaggga
gtagtgaccaactttgaaatcttccgaatgagagagaaacaggtacctgtggatgtggtg
gaaatgaaagagagtatcatagcctttgcttgggaaccaaatggaagcaagtttgccgtg
ctgcacggcgagactcctcgaatatcagtttccttttaccatgtaaaaaacaacgggaag
atcgagcttatcaaaatgtttgacaagcagcaggcaaatacaatcttttggagtccccag
gggcagttcgttgtgcttgctggcctgaggagcatgaatggtgccctggcgtttgtggac
acttctgactgtacgatgatgaacattgctgaacactatatggcctctgatgttgaatgg
gatcctacaggacgttatgttgtgacctccgtgtcctggtggagccacaaggtggacaat
gcttactggctgtggacctttcaggggcgacttcttcagaaaaacaacaaggaccgcttc
tgccagttactgtggagacctagacctacaactctgctcagtcaggatcagataaagcaa
attaagaaggatctgaagagatactccaagatttttgaacagaaggatcgtttgagtcaa
tccaaagcctccaaggaactggtagagagaaggcgtacaatgatggaagatttccggaaa
taccgcaagatggcccaggaactctacttggaacagaaaaatgagcgtctggaattgcga
ggaggggtggacacagacgaattagacagcaacgtagatgactgggaggaagagaccatc
gagtttttcgtcactgaagaaattattccccttggaaatcaggagtag

DBGET integrated database retrieval system