KEGG   Ornithorhynchus anatinus (platypus): 100083239Help
Entry
100083239         CDS       T01045                                 

Definition
6-phosphofructokinase, liver type-like
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:oaa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:oaa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:oaa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:oaa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:oaa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:oaa00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 751 aa AA seqDB search
MNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANWLSVSNIIQLGGTVIGSARC
KAFTTREGRLSAAYNLVQHGITNLCVIGGDGSLTGANIFRTEWGGLLEELVSQGKITEAV
AQKYCHLNVVGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMG
RHCGYLALVSALASGADWLFIPEAPPEDGWENHMCKRLGEMRSRGSRLNIIIIAEGAIDR
NGKPISSNYVKDLVVKRLGFDTRVTVLGHVQRGGTPSAFDRVLSSKMGMEAVMALLEATP
NTPACVVSLSGNQSVRLPLMECVQVTKEVQKAMDEKRFDEAILLRGRSFENNWNIYKLLA
HQKKALEKSNFSLAILNVGAPAAGMNAAVRSAVRIGISKGHTMYVVNDGFEGLAKGQVRE
VGWHDVAGWLGRGGSMLGTKRTLPKTCMEKIVESIRTYNIQGLLVIGGFEAYEGVLQLVE
ARGQYEELCIIMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVFIV
ETMGGYCGYLATVTAIAVGADAAYIYEDPFTIHDLKANVEHLTDKMKTDIQRGLVLRNEK
CHEHYTTEFLYNLYSSEGKGIFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWMSEK
LQEAYRRGRVFANSADSACVIGLKKKVVAFSPVTELKKVTDFEHRMPREQWWLNLRLMLK
MLANYQISLTEYVSGEMEHVTRRTLSIEKGF
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgcagtccgggctgtgactcgtatggggatatatgttggagcaaaagttttc
ctgatttatgagggctacgaaggcttggtggaaggaggagagaacattaaacaggcaaat
tggctgagcgtctccaatattatccagttgggaggtaccgtcattggcagtgctcggtgc
aaagcttttaccacccgagagggtcgcctgtccgccgcctataacttggtccagcatggc
atcaccaacctgtgcgtcatcggtggagatggcagtctgacgggcgccaatatcttccgc
acagaatggggtggcctgctggaggaactggtgtctcaagggaagatcacagaggcggtg
gcccagaagtactgtcacctgaacgttgttgggttggtgggctccatcgacaatgatttc
tgtggcacggatatgaccattggcactgactcagccctgcaccggatcatggaggtgatt
gatgccatcaccaccacagctcagagccatcagaggacatttgtgctggaagttatgggc
aggcactgtgggtacctggccttggtctcagccttggcatctggagctgactggctcttc
atccctgaggctccgccggaggacggctgggagaatcacatgtgcaagagacttggggag
atgcgtagcagagggtccagactcaatatcatcatcattgctgaaggtgccatcgataga
aatggaaaacccatctcatccaattacgtaaaggatctggttgttaagcgccttggattt
gatactcgggtgacggtcctgggccacgtacagcgaggaggaacgccctctgcttttgat
cgggtcttgagcagtaaaatggggatggaggccgtgatggcgttactggaagccacgccc
aacacaccagcctgtgtcgtgagtctgtctgggaaccagtctgtccgactgcccctgatg
gagtgcgttcaggtgacaaaagaagtgcagaaagccatggatgagaaaaggtttgatgaa
gcgatccttctccgagggaggagttttgaaaataactggaacatttacaagctccttgcg
caccagaagaaagcgctggaaaagtccaacttctccttagcaattttgaacgtcggggca
ccagcagccgggatgaatgcggcagtgaggtcagcggtgaggatcggaatctcgaagggg
cacacgatgtacgtcgtcaacgacggcttcgagggcttagccaaggggcaggtccgagag
gtgggctggcatgacgtagccggctggctgggccgcgggggatcgatgctgggaaccaag
agaaccctcccgaagacatgcatggagaaaattgtggaaagcattcggacttacaacatc
cagggtctgttggtcatcggggggtttgaggcgtatgagggcgtgctgcagctggtcgag
gcccgagggcagtacgaggaactgtgcatcatcatgtgcgtcatcccggccaccatcagc
aacaacgtccccggcaccgacttcagcctcggctcggacaccgccgtcaacgccgccatg
gagagctgcgaccggatcaagcagtcggcctccgggaccaagcgccgggtgttcatcgtg
gagacgatgggcgggtactgcggctacctggccacggtgacggccatcgccgtcggagca
gacgccgcttatatctacgaagatcctttcaccatccacgacttaaaggcaaatgtggag
cacttgaccgacaaaatgaaaacagacattcagagaggcctggtgctccgaaatgaaaag
tgtcacgaacattacacgacagaattcttgtacaatctgtactcatccgaggggaaaggg
attttcgactgtaggaccaacgtcttgggccatctgcagcagggaggagctcccaccccg
ttcgaccgtaactacggcaccaagttgggagtgaaggctatgctgtggatgtcggaaaaa
ctgcaggaggcctaccgcaggggtcgcgtgttcgccaattcggcagactcggcctgcgtg
attggcctgaagaagaaagtggtggccttcagccccgtgaccgaactcaagaaagtcacc
gatttcgaacacaggatgccccgggagcagtggtggctaaatctgcgcctgatgctgaag
atgctggccaactatcagatcagcctgaccgagtacgtctccggggagatggagcacgtc
acccgacgcaccctcagcatcgagaagggcttctaa

DBGET integrated database retrieval system