KEGG   Ornithorhynchus anatinus (platypus): 100083283Help
Entry
100083283         CDS       T01045                                 

Gene name
CLK1
Definition
(RefSeq) dual specificity protein kinase CLK1
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Legionellosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    100083283 (CLK1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100083283 (CLK1)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100083283 (CLK1)
Spliceosome [BR:oaa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100083283 (CLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 482 aa AA seqDB search
MRHSRRTACPDWDEKESWPQRRCGSHKRKRRSPSSARDNKRCKHNHSKGSDSRYLEARSL
NERDYHNRRYIDEYRNDDSQGFEFGHHHRDHESGYHNHSSKSSGRSGRSSYKKKFNFHRS
SSHHSHTKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVATLGEGAFGKVVECIDHKA
GGRHVAVKIVKNVDRYCEAARSEIQVLEHLNATDPNSTFRCVQMLEWFDHHGHVCIVFEL
LGLSTYDFIKENSFLPFRLDHIRQMAYQICKSVNFLHSNKLTHTDLKPENILFVQSDYVE
EYNPKMKRDERTLKNADIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVW
SIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPMHMIQKTRKRKYFHHDQLDWDEHS
SAGRYVSRRCKPLKEFMLSQDTDHEHLFDLIQKMLEYDPSKRITLREAMKHPFFSCLKKE
KM
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcggcactcgagaagaacggcttgtcccgactgggacgagaaggagagctggcctcag
cggaggtgcggcagccataaacggaagaggaggtcacccagcagtgcccgggacaacaag
cgctgcaagcataatcactcaaaagggtctgatagccgttatttggaagccaggtctctg
aacgaaagagattatcataatcggcgctacatcgacgagtataggaatgatgacagtcaa
ggatttgaatttgggcatcatcacagagaccatgagagtggttatcacaaccacagtagc
aagtcctctggtagaagtggaagaagtagttacaaaaagaagttcaactttcatcgtagc
tcctcgcaccattcgcatacgaagagtcaccgaaggaaaagatccaggagtgtagaggat
gatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaagatacgaaatc
gtggctactttaggcgaaggggcctttgggaaagtggtggaatgcatcgatcataaagcg
ggcggtaggcacgttgcagttaaaatcgttaaaaatgtcgatagatactgtgaagcggcc
cgttccgaaatacaagtgttggagcacttaaacgcaacagacccaaacagcacattccgc
tgcgtccagatgctggagtggttcgatcaccacggtcacgtttgcatcgtctttgaactg
ctggggctcagtacctatgacttcattaaagaaaacagttttttgccttttcggctggat
cacatcaggcagatggcataccagatctgcaaatctgtaaatttcttgcacagtaacaaa
ctgactcacacagatctgaagccggaaaacattttatttgtgcagtccgattacgtggag
gagtataatcccaaaatgaaacgggatgaacgcacgctgaaaaatgcggacatcaaagtt
gtggacttcggaagcgcaacgtacgacgacgaacatcacagcacgctagtgtccacgaga
cactacagagcccccgaggtcattctagctctcggatggtcccagccctgtgatgtctgg
agcatcggctgcattctcattgaatattacctgggcttcaccgtgtttccgacacacgac
agtaaagagcacttggcaatgatggaaaggatcctaggacctctacccatgcatatgata
cagaaaacgaggaaacgaaagtacttccaccatgaccagctggactgggacgagcacagc
tctgccggaagatacgtctcccgccgctgcaaaccactaaaggaattcatgctctctcag
gataccgaccacgagcacctgttcgacctcatccagaagatgctggaatacgatccgtcc
aaaagaatcactctgagagaagccatgaagcatcctttcttttcctgcctgaagaaagaa
aagatgtga

DBGET integrated database retrieval system