KEGG   Ornithorhynchus anatinus (platypus): 100083315Help
Entry
100083315         CDS       T01045                                 

Gene name
SETDB2
Definition
SET domain, bifurcated 2
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:oaa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 805 aa AA seqDB search
MEEKNGDAKAFWKELEDGGKVDLIFEHVQSILQSLKQKIKDGSATYQEYTQAMILVNEAK
SNSLLQIKDGALERDKEPRSEETASPVFNEESGPQMPSPLYVFKPNLFVLYPTLRRQLAD
WIPASSPRRAVVKDHPWEWDQPSLDPPQGISSVSSEAPSVLIFSGEVPAGSGPNGTTPEQ
IRSLPLESQWVVSAAIGMKEAELMALKLRTTEDKAKSAAVPGVCTSEEKKSPLYLPYQSH
NCHKCLTKRPLISFKGENPLKIPILCHFQRRHAKTNSHSAILHVIYKTPCRRSLRNFQEV
QRYLREIDCNFLSIDQFSFNTYVQLNRSILNPDAIVSDFDVSKGAESVPISFCNEIDSRR
LPHFKYRKSTWPRGYYLNNFSGAFTDSCDCSEGCTDISKCACLQLTARGRPEGSPFSNKM
EPPGYRYKRLQRPVPTGVFECSLLCKCSRWTCQNRVVQHGLQVRLQVFNAEKKGWGVRCL
DDIDKGTFVCTYSGRLLSRACLEKSSCAQQDDSLKSNSSMPLSKQRKIEVACSDSEGKFV
KTRKDISGNTENQECLLPTNGDPEDRVKDLKYGYNPRNRSHPGIRRPQSKTAILQSHRKK
LGLAVLEFSVSSEEEEEGGRVGGTHSIKIKLSPKTEKKPSSDSVEGFKDDLLSKSNVVDA
SSLKEETPVENVCEQVTEIVEDQEDQDEKNLESPNPGAFGSEKFPSETQKDFLKTFNKEG
TYLLDATKEGNIGRFLNHSCCPNLFVQNVFVETHDRNFPWVAFFTNRHVKAGTELTWDYG
YEAGSTPEREVPCLCGFQKCRKRIL
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaaatggtgatgcgaaggctttttggaaggagcttgaagatggtggaaaa
gtggacttgatatttgagcatgtacaaagtatactacagtctctgaaacaaaagatcaag
gatggatctgccacgtatcaagaatatacccaagcaatgatcctggtaaatgaagcgaag
agtaacagtttgctgcagataaaggatggagcacttgaaagggacaaagaacccagaagt
gaagaaacagcatctcctgtatttaatgaagagtctggtccccagatgccttcacctttg
tatgtattcaagccaaatctctttgtcctataccccactctgaggaggcagttagccgat
tggatacctgcttccagtccaaggagagctgtagtgaaggaccatccatgggagtgggac
caacctagtctggacccacctcagggcatttcttcagttagttctgaggccccttcagtt
cttatcttctctggggaggttccagcaggttctggacctaatggaaccacccctgagcag
atcagatccttgccactggaaagccagtgggttgtttcagcagccatagggatgaaggaa
gcagaactgatggctctcaagctaagaaccacagaggataaagcaaagtcagctgcagta
cctggagtttgcacttctgaagagaaaaaatcccctttatatttgccttatcagagtcat
aactgccataaatgtctgactaaaagaccgctgatctccttcaaaggggaaaacccactt
aaaatacccatcctatgtcacttccagaggcgacatgcaaagactaactctcattctgca
atacttcacgtgatttacaaaaccccttgtcgtaggagtctgcgaaactttcaggaagtc
cagcgttacctgcgtgagatcgattgcaattttctaagtatagatcagttttctttcaac
acctacgtccaactcaataggagtatcctcaacccagatgcaatcgtttccgactttgat
gtcagcaagggagctgaatccgtgcccatttccttctgtaatgaaattgacagcaggagg
ttacctcacttcaagtacagaaagagcacgtggccacgtggctattatctaaacaacttc
tctggtgcatttactgactcttgtgattgctcagaaggctgcactgacatatcgaaatgt
gcttgccttcagctgacagcaagaggccgccctgaagggtctcccttttcaaataagatg
gagcctcctgggtatcgatataaacgactgcagagacctgtgcctactggggtgttcgaa
tgcagtctgctatgcaaatgcagccgctggacctgtcagaacagagttgtgcagcatggc
cttcaggtgcggctacaggtgttcaatgcggagaagaaaggctggggggtccgctgccta
gatgacattgacaagggaacatttgtctgcacttattcaggcaggttactaagcagagcg
tgtctggagaaaagcagttgtgcccagcaggatgattctttgaaaagtaacagctccatg
ccactttcaaagcaaaggaagatagaagttgcctgttcagattctgaggggaagtttgtc
aaaactagaaaggatatctctggcaacactgagaatcaggaatgcctcctcccaaccaat
ggtgacccagaagaccgtgtgaaggatctgaagtatggatataatccaaggaatcgaagt
catccaggcattagaaggcctcagtcgaaaacagctattcttcagagtcacagaaaaaaa
ctgggacttgcagttctggaatttagtgtgagctcagaagaagaagaagaaggaggaaga
gttggtggaactcattctatcaaaattaaactaagccccaaaacagagaaaaaaccaagc
tctgattctgtggaaggttttaaagatgacctgctgagcaaatcaaatgtggtggatgcc
tccagtctgaaagaggagactccagtggagaatgtatgcgaacaagtgactgaaattgtt
gaggaccaagaggaccaagatgaaaaaaacttggagagtccaaatccaggggcctttggt
agtgaaaaatttccgtctgaaacccagaaggattttttgaagacatttaataaagaaggc
acttatttattggatgccacaaaagaaggaaatatagggcgtttccttaaccatagctgt
tgccccaatctctttgtgcagaatgtttttgtggagacacacgatagaaatttcccatgg
gtggcatttttcacaaacagacatgtgaaggctggaaccgaattaacttgggattatggt
tatgaagccggaagcaccccagagagagaggtcccatgtctctgtggatttcagaaatgt
aggaaaagaatattataa

DBGET integrated database retrieval system