KEGG   Ornithorhynchus anatinus (platypus): 100083387Help
Entry
100083387         CDS       T01045                                 

Definition
(RefSeq) HRAS-like suppressor 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00564  Glycerophospholipid metabolism
oaa00565  Ether lipid metabolism
oaa00590  Arachidonic acid metabolism
oaa00591  Linoleic acid metabolism
oaa00592  alpha-Linolenic acid metabolism
oaa01100  Metabolic pathways
oaa04014  Ras signaling pathway
oaa04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100083387
   00565 Ether lipid metabolism
    100083387
   00590 Arachidonic acid metabolism
    100083387
   00591 Linoleic acid metabolism
    100083387
   00592 alpha-Linolenic acid metabolism
    100083387
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100083387
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100083387
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100083387
    3.1.1.32  phospholipase A1
     100083387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT Calici_PP_N Peptidase_C97
Motif
Other DBs
NCBI-GeneID: 100083387
NCBI-ProteinID: XP_001513952
Position
Un
AA seq 162 aa AA seqDB search
MRALIPEPNPGDLIEIFRMCYRHWAIYVGDGYVVHLVPPSEYAGAGASSIMSALTDKALV
KKELLYDVVGRDRYRINNKHDTVHQPLPPSKIIQNAEEQVGREVLYKLTSENCEHFVNEL
RYGVPRSDQVRDALVGASVAGVGLAVVGLIGVMLSRNKRQNQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctctcattccagagccaaaccccggagacctgattgagattttccgaatgtgc
tacagacactgggccatctatgtgggcgatggctatgtggtccatctggttcccccaagt
gagtacgccggggccggtgcctcgagcatcatgtctgccctgacggataaagccttggta
aagaaggagctgctctatgacgtggttggaagggacaggtatcggatcaacaacaaacac
gatacagttcaccagcctctgcctcccagcaaaatcatccagaatgccgaggagcaggtg
ggaagagaggtcctctacaagctcaccagtgaaaactgcgagcactttgtgaacgaactg
agatatggggtgcccagaagtgaccaggtccgagatgccttggtgggagcaagtgtggca
ggagtgggcctagctgtggtgggccttattggtgtgatgttatcaaggaacaaacgtcaa
aatcaataa

DBGET integrated database retrieval system