KEGG   Ornithorhynchus anatinus (platypus): 100083474Help
Entry
100083474         CDS       T01045                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100083474 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100083474 (CYSLTR2)
G protein-coupled receptors [BR:oaa04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    100083474 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 327 aa AA seqDB search
MEQQGSPANDTNCTIQDFKRAIYPPVYLSIFVLGILGNGFSIFIFLQSFRKQTSMNVFML
NLAISDFLFVFTLPFRADYYLKNSKWVFGDITCRLMSYSWYVNMYSSIYFLTVMSIVRFL
AIVHPFRLLSLTSIKGARILCVTIWTFVMVISATLLKGGSSQKNNETSCLDPEKEKIQRL
LILNNIVLAVGFILPLGTLSVCYILIIRTLLKPRVPESGLRPSNKKALLTISIILFFFLV
CFLPYHLLRTVHLLAWSENKCHSRVHKAVVITLCLAAANNCLNPLLYYFSGENFKERLIA
VFKRGPLPKQTQQGHLYIVEAENLVET
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcaagggagccccgccaacgacactaactgcaccattcaagacttcaaaaga
gccatctacccacctgtgtatttgagcatatttgtgttgggaattttgggaaatggcttt
tccatattcattttccttcagtcttttaggaaacaaacctcaatgaatgttttcatgttg
aacttggccatttcggatttcttatttgtgtttacgctgcccttccgagctgactactac
ttgaagaattccaagtgggtgtttggagacatcacctgcaggttaatgtcctattcttgg
tacgtcaatatgtacagcagcatctatttcctgaccgtgatgagcatcgtccgtttcctg
gctattgtgcaccctttccggctcttaagtctgaccagcatcaagggtgcccggatcctg
tgtgtgacaatatggacttttgtgatggtgatttctgctacgcttttgaaaggcggatct
tcccagaagaataatgaaacttcatgcttagaccctgagaaagagaaaatccagaggttg
ctcattctgaacaatatcgtcttggccgtgggtttcattctgcccctgggcacactgagt
gtctgttacatactgatcatcaggactctgctcaaacctcgggtcccagaatcggggctc
agaccctcaaacaaaaaggcgttattaaccatctctattatattgttctttttcctggtt
tgttttctgccttatcaccttctgagaaccgttcacttgttggcgtggagcgagaataag
tgccacagtcgtgtgcataaagctgtggtgatcaccctgtgcttagctgcagccaataac
tgcctgaatcctttgctctattacttttcgggggaaaatttcaaagagagacttatcgct
gtattcaaaagaggacccctgccaaaacaaacgcaacagggccatctgtacattgtggaa
gcagaaaacctagtggagacctga

DBGET integrated database retrieval system