KEGG   Ornithorhynchus anatinus (platypus): 100083540Help
Entry
100083540         CDS       T01045                                 

Definition
integrin beta-8-like
Orthology
K06591  
integrin beta 8
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:oaa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:oaa04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:oaa04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:oaa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:oaa04510]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:oaa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:oaa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:oaa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 356 aa AA seqDB search
MVRLTLHGVCLDKENDYVVFNITVTMEGCEVAGKRSYAVIKPIGFNETTIVNIYNNCTCQ
CHDNRRHKGKCTEEASLGCQSSHCEDTNCGSDEDQSSPESCRIHRDQPPCSGRGVCLCGK
CLCHKTKLGKIHGKYCEMDDFSCPYHHGNLCAGNGVCEAGNCRCFGGWEGDRCQCPAGSA
KHCVNAQGQTCSGRGTCVCGKCECTDPRSVGRLCEHCPACSPACDGKRDCDECHRSPNAS
QALRDQCKTSCAPMVQHMDQTAECLSSPSYFRVFFIIFIITFLIGLLKILIIRQIILQWN
GNKVKSADYRVSKKKKEKMFLPTVCPRTVTYQRDKPEEIHINITKLHAHETFKCNF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcctcactttgcatggagtttgccttgacaaagaaaatgattatgtggttttc
aatataactgtgacaatggagggttgtgaagtagctggaaagagaagctatgcggtcatc
aagccgattggtttcaatgaaaccactatagttaatatatataataattgtacctgccag
tgtcacgacaacagaagacacaaaggaaagtgtacagaggaagcttctctgggctgtcaa
agctctcactgcgaagacacaaactgtggttcagatgaagatcagtcttctcccgagagt
tgcagaatacaccgggatcaaccaccttgcagtggtcgaggagtttgcttatgtggaaaa
tgtttatgtcacaaaactaaactgggaaaaatacatgggaaatactgtgaaatggatgac
ttttcttgcccatatcaccatggaaatctctgcgccggtaatggcgtctgtgaagccgga
aactgcaggtgcttcggtggctgggaaggagatcgctgccaatgtccagccgggtcagcc
aagcactgtgtcaacgcccaaggccagacgtgcagtggacgaggaacctgtgtgtgtggc
aagtgcgagtgcacggaccccaggagcgtcggccgcctgtgtgagcactgtccggcctgc
agccccgcctgtgacgggaagagagattgtgacgagtgtcaccgctctcccaatgcatct
caggctctacgtgaccagtgcaaaacctcatgtgctcctatggtacaacacatggaccaa
actgcagaatgtctttctagcccaagctacttcagagtattttttataatcttcataatt
acatttctaattgggctacttaaaatacttatcatcagacagatcattctacagtggaat
ggcaataaagtgaaatctgcggattaccgagtttctaaaaaaaagaaggaaaaaatgttt
ctgccgactgtttgcccaagaacagtaacgtatcaacgtgataagcctgaagaaattcat
atcaatatcaccaagttacatgcacacgaaactttcaagtgcaacttctaa

DBGET integrated database retrieval system