KEGG   Ornithorhynchus anatinus (platypus): 100083540Help
Entry
100083540         CDS       T01045                                 

Gene name
ITGB8
Definition
(RefSeq) integrin subunit beta 8
  KO
K06591  
integrin beta 8
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100083540 (ITGB8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100083540 (ITGB8)
   04514 Cell adhesion molecules (CAMs)
    100083540 (ITGB8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100083540 (ITGB8)
  Cellular commiunity
   04510 Focal adhesion
    100083540 (ITGB8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100083540 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100083540 (ITGB8)
   05414 Dilated cardiomyopathy (DCM)
    100083540 (ITGB8)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100083540 (ITGB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 331 aa AA seqDB search
MEGCEVAGKRSYAVIKPIGFNETTIVNIYNNCTCQCHDNRRHKGKCTEEASLGCQSSHCE
DTNCGSDEDQSSPESCRIHRDQPPCSGRGVCLCGKCLCHKTKLGKIHGKYCEMDDFSCPY
HHGNLCAGNGVCEAGNCRCFGGWEGDRCQCPAGSAKHCVNAQGQTCSGRGTCVCGKCECT
DPRSVGRLCEHCPACSPACDGKRDCDECHRSPNASQALRDQCKTSCAPMVQHMDQTAECL
SSPSYFRVFFIIFIITFLIGLLKILIIRQIILQWNGNKVKSADYRVSKKKKEKMFLPTVC
PRTVTYQRDKPEEIHINITKLHAHETFKCNF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagggttgtgaagtagctggaaagagaagctatgcggtcatcaagccgattggtttc
aatgaaaccactatagttaatatatataataattgtacctgccagtgtcacgacaacaga
agacacaaaggaaagtgtacagaggaagcttctctgggctgtcaaagctctcactgcgaa
gacacaaactgtggttcagatgaagatcagtcttctcccgagagttgcagaatacaccgg
gatcaaccaccttgcagtggtcgaggagtttgcttatgtggaaaatgtttatgtcacaaa
actaaactgggaaaaatacatgggaaatactgtgaaatggatgacttttcttgcccatat
caccatggaaatctctgcgccggtaatggcgtctgtgaagccggaaactgcaggtgcttc
ggtggctgggaaggagatcgctgccaatgtccagccgggtcagccaagcactgtgtcaac
gcccaaggccagacgtgcagtggacgaggaacctgtgtgtgtggcaagtgcgagtgcacg
gaccccaggagcgtcggccgcctgtgtgagcactgtccggcctgcagccccgcctgtgac
gggaagagagattgtgacgagtgtcaccgctctcccaatgcatctcaggctctacgtgac
cagtgcaaaacctcatgtgctcctatggtacaacacatggaccaaactgcagaatgtctt
tctagcccaagctacttcagagtattttttataatcttcataattacatttctaattggg
ctacttaaaatacttatcatcagacagatcattctacagtggaatggcaataaagtgaaa
tctgcggattaccgagtttctaaaaaaaagaaggaaaaaatgtttctgccgactgtttgc
ccaagaacagtaacgtatcaacgtgataagcctgaagaaattcatatcaatatcaccaag
ttacatgcacacgaaactttcaagtgcaacttctaa

DBGET integrated database retrieval system