KEGG   Ornithorhynchus anatinus (platypus): 100083540Help
Entry
100083540         CDS       T01045                                 

Gene name
ITGB8
Definition
(RefSeq) integrin subunit beta 8
  KO
K06591  integrin beta 8
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04151  PI3K-Akt signaling pathway
oaa04510  Focal adhesion
oaa04512  ECM-receptor interaction
oaa04514  Cell adhesion molecules (CAMs)
oaa04810  Regulation of actin cytoskeleton
oaa05165  Human papillomavirus infection
oaa05410  Hypertrophic cardiomyopathy (HCM)
oaa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
oaa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100083540 (ITGB8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100083540 (ITGB8)
   04514 Cell adhesion molecules (CAMs)
    100083540 (ITGB8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100083540 (ITGB8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100083540 (ITGB8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100083540 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100083540 (ITGB8)
   05414 Dilated cardiomyopathy (DCM)
    100083540 (ITGB8)
  Infectious diseases
   05165 Human papillomavirus infection
    100083540 (ITGB8)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100083540 (ITGB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF_2
Motif
Other DBs
NCBI-GeneID: 100083540
NCBI-ProteinID: XP_016083870
UniProt: K7E7K5
Position
Un
AA seq 331 aa AA seqDB search
MEGCEVAGKRSYAVIKPIGFNETTIVNIYNNCTCQCHDNRRHKGKCTEEASLGCQSSHCE
DTNCGSDEDQSSPESCRIHRDQPPCSGRGVCLCGKCLCHKTKLGKIHGKYCEMDDFSCPY
HHGNLCAGNGVCEAGNCRCFGGWEGDRCQCPAGSAKHCVNAQGQTCSGRGTCVCGKCECT
DPRSVGRLCEHCPACSPACDGKRDCDECHRSPNASQALRDQCKTSCAPMVQHMDQTAECL
SSPSYFRVFFIIFIITFLIGLLKILIIRQIILQWNGNKVKSADYRVSKKKKEKMFLPTVC
PRTVTYQRDKPEEIHINITKLHAHETFKCNF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagggttgtgaagtagctggaaagagaagctatgcggtcatcaagccgattggtttc
aatgaaaccactatagttaatatatataataattgtacctgccagtgtcacgacaacaga
agacacaaaggaaagtgtacagaggaagcttctctgggctgtcaaagctctcactgcgaa
gacacaaactgtggttcagatgaagatcagtcttctcccgagagttgcagaatacaccgg
gatcaaccaccttgcagtggtcgaggagtttgcttatgtggaaaatgtttatgtcacaaa
actaaactgggaaaaatacatgggaaatactgtgaaatggatgacttttcttgcccatat
caccatggaaatctctgcgccggtaatggcgtctgtgaagccggaaactgcaggtgcttc
ggtggctgggaaggagatcgctgccaatgtccagccgggtcagccaagcactgtgtcaac
gcccaaggccagacgtgcagtggacgaggaacctgtgtgtgtggcaagtgcgagtgcacg
gaccccaggagcgtcggccgcctgtgtgagcactgtccggcctgcagccccgcctgtgac
gggaagagagattgtgacgagtgtcaccgctctcccaatgcatctcaggctctacgtgac
cagtgcaaaacctcatgtgctcctatggtacaacacatggaccaaactgcagaatgtctt
tctagcccaagctacttcagagtattttttataatcttcataattacatttctaattggg
ctacttaaaatacttatcatcagacagatcattctacagtggaatggcaataaagtgaaa
tctgcggattaccgagtttctaaaaaaaagaaggaaaaaatgtttctgccgactgtttgc
ccaagaacagtaacgtatcaacgtgataagcctgaagaaattcatatcaatatcaccaag
ttacatgcacacgaaactttcaagtgcaacttctaa

DBGET integrated database retrieval system