KEGG   Ornithorhynchus anatinus (platypus): 100083730Help
Entry
100083730         CDS       T01045                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2-like
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 282 aa AA seqDB search
NSKSIQGLVGLRNLGNTAFPTEFARLIQALWTSSANDVVSPSEFKTQIQRYAPRFVGYNQ
QDAQEFLRFLLDGLHSEVNRIMVRPKSHAENLDHLPDEEKGRQMWRKYLEREDSRIGDLF
VGQMKSSLTCTECGYCSTVFDPFWDLSLPITKRGFPEVTLMDCLRLFTKEDVLDGDEKPT
CCRCRARKRCIKKFSIQKFPKILVLHLKRFSESRIRTSKLTTFVNFPLKDLDLREFASES
SNHAIYNLYAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
aattccaagagcatccagggtctggtcggcctgcgcaacttggggaacacggccttcccc
acagagtttgccagactgatccaggcactgtggacttcatcagccaacgacgtggtgagc
ccgtccgagttcaagacccagatccagagatacgcccctcgcttcgtcggctacaaccag
caagatgcccaggaattcctgcgatttctcctcgacgggctccacagtgaagtgaaccgg
atcatggtgcggcccaagtcccacgctgagaacctcgatcaccttccggatgaggagaaa
ggaaggcaaatgtggaggaagtacctggaacgggaagacagtcggattggggacctgttt
gtcgggcaaatgaagagctccctgacctgcaccgagtgcggttactgctccacggtcttt
gaccctttctgggatctctccctccccatcaccaagcggggcttccctgaggttactctg
atggactgtttgaggctcttcaccaaagaggacgttcttgatggagatgagaagccgaca
tgctgtcgctgccgagctaggaaaagatgtatcaagaagttctccatccagaaattccca
aagatcctggtgctccatctgaagcggttctcggaatccaggatacgaaccagcaagctc
accacctttgtgaacttcccactcaaggatctggacttgagggagtttgcctcagagagc
agcaatcacgccatttacaacctgtacgcggtgtccaatcactccgggacgaccatgggg
ggccactacactgcatactgccggagcccggtgactggcgagtggcacacgttcaacgac
tccaggtga

DBGET integrated database retrieval system