KEGG   Ornithorhynchus anatinus (platypus): 100083769Help
Entry
100083769         CDS       T01045                                 

Gene name
PDE6B
Definition
phosphodiesterase 6B, cGMP-specific, rod, beta
Orthology
K13756  
rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta [EC:3.1.4.35]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Purine metabolism
Phototransduction
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100083769 (PDE6B)
 Organismal Systems
  Sensory system
   04744 Phototransduction
    100083769 (PDE6B)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     100083769 (PDE6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 856 aa AA seqDB search
MSVSKEEVEKFLDDNPAFVERYFEKKLNPENVATASAGGRPADFATFKELGQLEESEILF
EVIQDMQENINMEKVVFKILRRVCALISAERCSLFMYRQRNGVAELATRLFNIHTDSTLE
ECLVPPDSEIVFPLDIGVIGHVAQTKKMVNVKDVNECSHFSPFADETTDYVTRNILATPI
MNGKDVVAVIMAVNKTDGSFFTSSDEDIFLKYLNFASLNLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKALYTVRAYLNCERYSVGLLDMSKEKEFFDVWPVLMGEVQPY
TGPRTPDGREILFYKVIDYILHGKEDIKVIPNPPDNHWALISGLPTYVAESGFICNIMNA
PAEEMFKFQEGPLDDSGWIIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMES
LTQFLGWSVLNTDTYDKMNKLENRKDIAQDMVLYHVKCDKDEIQEVLPTREKLGKEPADC
DEDELGKILKMELPGPNKFGIYEFHFSDLECTELELVKCGIQMYYELGVVKKFQIPQEVL
VRFLYSISKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEALAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLADETLNIYQNLNRRQFEHVIHLM
DIAIIATDLALYFKKRTMFQKIVDESKGYDDKKSWVEYLSLETTRKEIVMAMMMTACDLS
AITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCT
FVYKEFSRFHEEILPMFERLQNNRKEWKALADEYDDKIKALEEEKKKEEERLPSKKATTH
VCNGGPSPQSSTCTIL
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttagtaaagaagaggtagagaaatttctcgacgacaaccctgcgttcgtagag
cgatactttgaaaagaaactgaaccccgagaatgtagccacggcatcggcgggcggccgg
cctgctgatttcgcaactttcaaggaactcggtcagctggaagagagtgagatccttttt
gaggtgattcaagacatgcaggaaaacattaacatggagaaggtcgttttcaagatcctg
aggagagtgtgtgctctcatctcggccgagcggtgtagtctcttcatgtaccgtcagaga
aacggcgtagccgagctggcaacgaggctctttaatatccacacagatagcaccctggag
gagtgcttggtacctccagattcagaaattgtcttccctctggacattggcgttataggg
cacgttgctcagaccaagaaaatggtgaacgtcaaggacgtgaacgagtgctcccacttc
agtccgtttgctgacgagactacggattacgttactagaaacattctggcgacacccatc
atgaatggcaaagatgttgtcgctgtaatcatggctgtgaataaaaccgatggctcattt
ttcaccagctcagatgaagatattttcttgaagtatctgaattttgcctccttaaatctg
aaaatttaccatttgagttaccttcacaactgtgagacacgaagaggccaggtgctactg
tggtcagctaataaggtctttgaggagttgacagacatcgagaggcagttccacaaagct
ctttacacagtgagagcctatctgaactgtgagagatactctgtggggcttctggatatg
agcaaggaaaaggagttctttgatgtgtggccagttttaatgggagaagtccagccctac
acaggacctcggaccccagatggaagggaaatactcttttacaaagtcattgattacatc
ctccatggaaaagaagatattaaagttattccaaaccccccagacaatcactgggcgctg
atcagtggcctgccaacatatgtagcagagagtggctttatctgcaacattatgaatgct
ccagcagaggagatgtttaaatttcaggaaggccctttagatgactctgggtggattatc
aaaaatgtcctttccatgccaatagttaacaaaaaagaagaaattgttggtgtcgccact
ttttacaacaggaaagatggaaagccatttgatgaacaggacgaagtactcatggagtct
ctaacacagtttctcggctggtctgtactcaataccgatacctatgacaagatgaataaa
ttagagaatcggaaggacattgctcaggacatggtgctgtatcatgtgaaatgcgacaaa
gatgaaattcaagaagtcctgccaacacgagagaaactggggaaagagccggcagattgt
gatgaagatgaacttggtaaaatattgaaaatggaattgccaggtcctaacaaatttggg
atctacgagttccatttctctgatttggaatgcaccgaacttgagcttgtgaaatgcggc
attcaaatgtactacgagcttggagtggtgaagaagtttcagattccacaagaggtgctg
gtgagatttctgtattcaatcagcaaaggctaccggaggattacttaccacaactggcgt
cacggtttcaatgtggcacaaaccatgttcacccttttaatgaccggcaaactgaaaagt
tactacacagatttggaggctttggcgatggtgactgccggtctgtgtcatgatattgac
cacaggggaaccaacaacctttaccagatgaaatctcagaatccattagcaaagcttcat
ggatcatccattttagaaagacaccatttggagtttgggaagtttttacttgcagatgag
actctgaacatctaccagaatctcaaccgaaggcagtttgaacacgtgatccatttgatg
gatattgccatcatagccacggatttagcgctgtacttcaagaaaagaactatgtttcag
aagatcgttgatgaatccaaagggtatgatgataaaaagagctgggtagaatatttatca
ctggagactacgagaaaagagattgttatggcaatgatgatgacagcgtgtgacttatca
gctattaccaagccttgggaagtccagagtaaggttgctcttcttgtggcagctgaattc
tgggaacaaggtgacctggaaagaacggtccttgatcaacagcctattcctatgatggat
agaaataaagcggctgagcttccaaaacttcaagttggttttattgactttgtatgcaca
tttgtatataaggaattttcacgtttccatgaggaaattctgccaatgttcgagagattg
cagaataatagaaaggagtggaaagcccttgcagacgagtatgacgacaaaataaaagca
ctggaagaagaaaagaaaaaagaagaggagagactcccttcaaagaaagcgaccacacac
gtttgcaatggaggcccctcacctcagtcttcaacctgcaccatcctttaa

DBGET integrated database retrieval system