KEGG   Ornithorhynchus anatinus (platypus): 100083783Help
Entry
100083783         CDS       T01045                                 

Definition
histone deacetylase 9-like
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:oaa05203]
Human Diseases; Substance dependence; Alcoholism [PATH:oaa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 514 aa AA seqDB search
MMMPMVDPVIREKQLQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKELL
AIKQQQELLEKEQKLEQQRQEQEVERHHREQQLPPLRGKERGRERAVASTEVKQKLQEFL
LSKSATKDSPTKGKNHSMSRHPKLWTAHHTSLDQSSPPLSGTSPSYKYTLPGAQDANDDF
PLRKTESSVSSSSPASGPSSPSNGPTGNVTENEASVLPSTPHAEPMISQQRILIHEESMN
LLSLYTSPSLPNITLGLPAVPSQLNASSTLKEKQKSESQTLRQGVTLPGQYGGGTSASTG
HSHAALEGKPNSSHQALLQHLLLKEQMRQQKLLVSGGVPLHPQSPLATKERVSPGIRTAH
KLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKILSKSIEQLKQP
GSHLEEAEEELHGDHPMLEDRAPSSDHSIRNEGIGADADERLGYPAGTVKVKEEPLDSAD
DAQAQQTESGEQAAFMPQVIGKDLAPGFVIKVII
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcccatggtggacccagtcataagagagaaacagctgcaacaggagttactt
ctgatccagcagcagcagcaaattcagaagcaacttctgatagcggagttccagaaacag
cacgagaatctaactcgacaacatcaggcccaacttcaggaacatataaaggaacttctt
gccattaaacaacagcaagaactcctagaaaaggagcagaaattggagcaacagagacaa
gaacaagaggtggagagacatcaccgggaacagcagcttcctcctctcagaggcaaagaa
agaggccgagaaagggcagtagcaagtacagaagtgaagcagaagcttcaagagttcctg
ttgagtaaatctgcaacaaaagactctccaactaaaggaaagaatcattccatgagccgc
caccccaaactctggactgcccaccatacctcactggatcaaagctcaccacctctgagt
ggaacctctccatcctacaaatacaccttaccaggggcccaggatgccaatgatgacttt
cctcttcgaaaaaccgaatcctctgtcagtagcagctctccagcatctgggcccagttca
ccaagcaatggtcctactggaaatgtaacagaaaacgaagcatcagttttgccgtcaact
cctcacgctgagccaatgatttcacaacagcgtattctgattcatgaagaatccatgaac
ctgctgagcctatacacctccccttctttgcctaatattactttgggacttcctgcagtc
ccctcccagctcaatgcctcctctacactcaaagagaaacagaagagcgagtcccagaca
ttgaggcaaggagtgacccttccggggcagtatggtggagggacctcagcttccactggc
cactcccatgctgctttggagggaaaacccaatagcagccaccaggctctcctgcagcac
ttgttgcttaaagagcaaatgaggcagcaaaagcttcttgtgtcaggtggtgttcccctc
catcctcagtctcccctggcaacgaaggagagggtctcacccggcattcgcacagctcac
aagttgccccgccacaggccgttaaaccgaacccagtctgcccctttgcctcagagcacg
ttggcgcagctggtcattcagcaacaacaccagcagttcttggagaagcagaagcagtac
cagcagcagatccacatgaacaaaatcctttcgaagtctatcgagcaactcaaacaaccg
ggcagtcatctagaggaagccgaagaagagctgcatggagatcatcctatgctggaagac
cgagctccctctagtgaccacagcattaggaacgaaggcatcggagccgatgcggacgag
agactcggatacccagcagggaccgtgaaagtcaaggaggaaccgctagacagtgccgac
gatgctcaggcccagcaaacggaatctggggagcaggctgcttttatgccacaggtaata
ggaaaagatttagcaccaggatttgtaatcaaagtcatcatctga

DBGET integrated database retrieval system