KEGG   Ornithorhynchus anatinus (platypus): 100083809Help
Entry
100083809         CDS       T01045                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:oaa00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:oaa04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:oaa04070]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:oaa04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 690 aa AA seqDB search
ETSLPGLQDDQDLKFLLKGTQLQKVKSGSWRKDRFYKLQEDCKTIWQESKKMMRSPETQF
CEYHGRGLGGWMRSPLSWIHSCLRKADKNKDNKMSFKEVKNFLKEINVQVDDSYARWIFK
ECDKSNTDSLEDNEIEEFYKMLTKRPEIDEIFQSIAGSADTLSVDRLVQFLRLEQKEDAD
PKMAHSLIERYEPSETAKEAKEMTKDGFLMYLLSADGNVFNLAHKKVYQDMTQPLCHYLV
SSSHNTYLMEDQLTGPSSTEAYIRALSRGCRCVELDCWDGSGNEPVIYHGYTFTSKILFC
DAIQAIKNYAFKASPYPVILSLENHCSLEQQRVLARHMERILGDLLVVAPVDGMVNNFPS
PEQLKGKILLKGKKLNGLLDGPEAAGTDAAYVSDEDEAAEMEDESVKSKLKEKNSKESLK
LAKELSDLVTYCKSVHFEGFEGSARDRPFYEMSSLSENKALRLVHEEGTSFIRHNAKYLS
RIYPAGRRTDSSNYCPVGLWNVGCQIVALNFQTPGSEMDVYQGRFQDNGFSGYVLKPAFL
RDPASRFDPRDPSMEGPWWAPKKLSILVISGQQLPKVNKSKNSIVDPKVTVEVLGTPKDS
TSQQTPMVGNNGFNPQWNWDLQFNVTVPELALVRFVVDDYDISSKNDFVGQCTVPFTSLK
MGYRHIHLLSKNGDQYPSATLFVKIQIQDN
NT seq 2074 nt NT seq  +upstreamnt  +downstreamnt
agagacctccctgccaggcctgcaggacgatcaagacctcaagttcctcctcaagggaac
ccagctgcagaaggtcaagtcgggctcctggaggaaagacaggttctacaagctgcaaga
ggattgtaagaccatctggcaggagtccaagaagatgatgaggtccccagagactcagtt
ctgtgagtaccatggaagggggctgggaggctggatgagaagccccctaagttggatcca
ctcttgtctgaggaaagctgacaagaacaaagacaataagatgagtttcaaagaggtcaa
gaactttctgaaggagattaacgtgcaggtggatgacagctatgcaaggtggatctttaa
ggagtgcgacaagtccaacacagactccctggaggataacgagatagaggagttttacaa
gatgctgaccaagcgaccagaaatcgatgaaatcttccagtccatcgcgggctctgccga
cactctgtcagtggaccggttggtgcagttcctgaggttggagcagaaggaggacgcaga
ccctaagatggctcactctctcatcgagcgatatgagcccagcgagacagccaaggaggc
gaaggaaatgacaaaggacgggttcctcatgtacctgctctccgcggacggcaacgtctt
caacctggcccacaagaaagtgtaccaagacatgacccagcctctctgccactacctggt
gtcatcctcgcacaacacctacctcatggaagaccagctgaccgggcccagcagcaccga
ggcctacatccgggctctgtcccggggctgccgctgcgtggagctggactgctgggacgg
ctccggcaacgaacctgtcatctaccacggctacacattcacctccaagatcctcttctg
cgatgccatccaggccatcaagaactatgccttcaaggcttccccgtatccggtgatcct
gtccctggagaatcactgcagcctggagcagcagcgagtcttggcccggcacatggagag
aatcttgggggatcttctggtggtggcgccagtcgacgggatggtcaacaactttccatc
tcccgagcagctgaaggggaagatcctgctgaaagggaagaagctgaatggtttgctgga
cggccccgaggccgcgggcaccgatgccgcctacgtctcagacgaggacgaagctgctga
gatggaagacgaatctgtgaagagcaaattgaaagagaagaactcgaaggaatcgctaaa
gctggccaaggagctgtcggatctggtcacctactgcaagagcgtccacttcgagggttt
cgaagggtccgcgcgggaccggcccttctacgagatgtcgtcgctctcggagaacaaggc
cctgcggctggtgcacgaagaagggaccagtttcatccgccacaacgccaagtatctgag
tagaatctacccggccggccggcggaccgactcttccaactattgccccgtcggcctgtg
gaacgtcggctgtcagattgtggctctgaatttccagactccgggctcagagatggatgt
gtaccagggccggtttcaagacaatggattctccggctacgtcctcaagccggccttcct
gcgagaccccgcgtcccgcttcgaccccagagaccccagcatggagggcccctggtgggc
tcccaagaagctttccatcttggtgatctcgggacagcagctgcctaaggtgaacaagag
caaaaactccattgtggacccgaaggtgacggtggaggtgctcgggacgcccaaggacag
caccagccagcagacccccatggtggggaacaacggcttcaatccccaatggaactggga
cctccagttcaacgtgacagtccccgagctcgccctggttcgtttcgtggtggatgacta
cgacatctcgtccaagaatgactttgtgggccagtgcactgtccccttcaccagcctcaa
aatgggctaccgccacatccacctgctgtccaagaacggagaccagtacccatctgccac
cctcttcgtgaagatccagatccaggacaactag

DBGET integrated database retrieval system