KEGG   Ornithorhynchus anatinus (platypus): 100083809Help
Entry
100083809         CDS       T01045                                 

Gene name
PLCD1
Definition
phospholipase C, delta 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100083809 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100083809 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100083809 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100083809 (PLCD1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100083809 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 596 aa AA seqDB search
MSFKEVKNFLKEINVQVDDSYARWIFKECDKSNTDSLEDNEIEEFYKMLTKRPEIDEIFQ
SIAGSADTLSVDRLVQFLRLEQKEDADPKMAHSLIERYEPSETAKEAKEMTKDGFLMYLL
SADGNVFNLAHKKVYQDMTQPLCHYLVSSSHNTYLMEDQLTGPSSTEAYIRALSRGCRCV
ELDCWDGSGNEPVIYHGYTFTSKILFCDAIQAIKNYAFKASPYPVILSLENHCSLEQQRV
LARHMERILGDLLVVAPVDGMVNNFPSPEQLKGKILLKGKKLNGLLDGPEAAGTDAAYVS
DEDEAAEMEDESVKSKLKEKNSESLKLAKELSDLVTYCKSVHFEGFEGSARDRPFYEMSS
LSENKALRLVHEEGTSFIRHNAKYLSRIYPAGRRTDSSNYCPVGLWNVGCQIVALNFQTP
GSEMDVYQGRFQDNGFSGYVLKPAFLRDPASRFDPRDPSMEGPWWAPKKLSILVISGQQL
PKVNKSKNSIVDPKVTVEVLGTPKDSTSQQTPMVGNNGFNPQWNWDLQFNVTVPELALVR
FVVDDYDISSKNDFVGQCTVPFTSLKMGYRHIHLLSKNGDQYPSATLFVKIQIQDN
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaaagaggtcaagaactttctgaaggagattaacgtgcaggtggatgacagc
tatgcaaggtggatctttaaggagtgcgacaagtccaacacagactccctggaggataac
gagatagaggagttttacaagatgctgaccaagcgaccagaaatcgatgaaatcttccag
tccatcgcgggctctgccgacactctgtcagtggaccggttggtgcagttcctgaggttg
gagcagaaggaggacgcagaccctaagatggctcactctctcatcgagcgatatgagccc
agcgagacagccaaggaggcgaaggaaatgacaaaggacgggttcctcatgtacctgctc
tccgcggacggcaacgtcttcaacctggcccacaagaaagtgtaccaagacatgacccag
cctctctgccactacctggtgtcatcctcgcacaacacctacctcatggaagaccagctg
accgggcccagcagcaccgaggcctacatccgggctctgtcccggggctgccgctgcgtg
gagctggactgctgggacggctccggcaacgaacctgtcatctaccacggctacacattc
acctccaagatcctcttctgcgatgccatccaggccatcaagaactatgccttcaaggct
tccccgtatccggtgatcctgtccctggagaatcactgcagcctggagcagcagcgagtc
ttggcccggcacatggagagaatcttgggggatcttctggtggtggcgccagtcgacggg
atggtcaacaactttccatctcccgagcagctgaaggggaagatcctgctgaaagggaag
aagctgaatggtttgctggacggccccgaggccgcgggcaccgatgccgcctacgtctca
gacgaggacgaagctgctgagatggaagacgaatctgtgaagagcaaattgaaagagaag
aactcggaatcgctaaagctggccaaggagctgtcggatctggtcacctactgcaagagc
gtccacttcgagggtttcgaagggtccgcgcgggaccggcccttctacgagatgtcgtcg
ctctcggagaacaaggccctgcggctggtgcacgaagaagggaccagtttcatccgccac
aacgccaagtatctgagtagaatctacccggccggccggcggaccgactcttccaactat
tgccccgtcggcctgtggaacgtcggctgtcagattgtggctctgaatttccagactccg
ggctcagagatggatgtgtaccagggccggtttcaagacaatggattctccggctacgtc
ctcaagccggccttcctgcgagaccccgcgtcccgcttcgaccccagagaccccagcatg
gagggcccctggtgggctcccaagaagctttccatcttggtgatctcgggacagcagctg
cctaaggtgaacaagagcaaaaactccattgtggacccgaaggtgacggtggaggtgctc
gggacgcccaaggacagcaccagccagcagacccccatggtggggaacaacggcttcaat
ccccaatggaactgggacctccagttcaacgtgacagtccccgagctcgccctggttcgt
ttcgtggtggatgactacgacatctcgtccaagaatgactttgtgggccagtgcactgtc
cccttcaccagcctcaaaatgggctaccgccacatccacctgctgtccaagaacggagac
cagtacccatctgccaccctcttcgtgaagatccagatccaggacaactag

DBGET integrated database retrieval system