KEGG   Ornithorhynchus anatinus (platypus): 100083966Help
Entry
100083966         CDS       T01045                                 

Definition
nuclear envelope pore membrane protein POM 121-like
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:oaa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 646 aa AA seqDB search
DHLASQNRLALSPRRRYPIQQAHYASLGALPTVCWDGYQRKNVLSSRNSNMVCSPVTVKI
ARPDHGLTRSPGLEQSISSMMSLPSESPPDPCAKETVLSALKESRKRTVQEEEDDDEEEG
DHRIVSEGLESKRRRHDSSGSGQSAFEPLVANGAPASLVPKPGSLKRSLNAHCPDDSWSK
RSRSSSVSSLSHTYSGGIPSSSRNAIASSYSSSRGFSQLWKRSGPSSSPLSSPASSRSQT
PERPVKKAREEEPQPSGSSAALMSDKELSANTSLDTPTSKKQNSWSSPTASSGSGKRKRK
IPLLASRRGEQLVLPPPPQLGYSVSAEDLDLEKKAALQWFNRVLEDKSDSTPKSVPEVPP
ASLPSSLSFTLTPAGPTLSPAVAPKPDPAASTNPLLESLKKMQNTPSPPIVTEAPAATAI
APAASPAPAPLKPPDQPPAQPPPTFLLDTPAAPLVGPLSKPTPAPLPETPVKLAASLKPS
ILFGMLSAPAAAPAVAAPAAAPVTPTPVFKPIFGAPPKSESGTPLAAGSSALAPAGAAPA
PSTPNFKPIFGDVGPPAAGPLAGVASPFAFKQTPPPAPAPAVTSAAQLFAAAESKPVFGG
TSAPAFGQSAPTPGAGTAGSTLTFGTPATPTQGFVGTGPTFAPSCR
NT seq 1942 nt NT seq  +upstreamnt  +downstreamnt
ggaccacctggcttcccagaatcggctggcgctgtctcctcgccggcggtaccctatcca
gcaggcccattatgcctccctgggggctctccccaccgtgtgctgggatggttatcagag
gaagaacgtgctctcctcccgcaactccaacatggtctgcagccccgtcaccgtcaagat
cgcccggccggaccacggcctgacccgctctccaggcctggagcagagcatttcctcgat
gatgtctttgccgtccgagagccctccggacccgtgcgcgaaagagacggtgctcagcgc
cctcaaagagagccggaaaagaactgtgcaggaggaggaggatgacgacgaggaggaggg
cgaccaccggatcgtctccgaggggttggagagtaagcgacggcgccacgacagcagtgg
gagcggacagtcggcgtttgagcccctggtggcaaacggggccccggcttcactggtgcc
caagcccggctccctgaagaggagcctcaatgctcactgcccggacgacagctggagcaa
gcgatcccgcagctcgtccgtcagttctctgagccacacgtactccggcggcatccccag
ctccagccgtaatgccatcgccagctcctacagctcctcccggggcttctcccagctgtg
gaaaagaagcggtcccagcagttcgccactctccagcccagcttcatcccgctcccagac
gcctgagaggcccgtgaagaaagccagggaagaggagccgcagccgtccggctcctcggc
cgccttgatgtccgacaaggagctctcggccaacacgtccctggacacccccacaagtaa
gaaacagaattcctggagttccccgacagcttccagcggcagcggaaagcgcaaacggaa
gatcccgctgctggcttcccggcgaggggagcagctggtcttgcccccgcctccccagct
gggctattccgtctcggccgaagacctggacttggagaagaaggcggcgttgcagtggtt
caacagagtcttggaggataagtcagattccacccccaagtcggtcccagaggtccctcc
cgccagtctgccgtcttctctctccttcaccctgacgcccgccggccccacgctctcacc
ggccgtcgcccccaaaccggatcccgccgcctccaccaacccgctgctggagagtctgaa
gaagatgcagaacaccccgagcccacccatcgtcacagaagctccggccgccaccgccat
cgccccggcagcgtccccggcgccggccccgctgaagcccccagaccagccgccggccca
gcctccccctaccttcctcctggacactcccgccgcacccctcgtcggccccctcagcaa
gccgacccccgcccctctgcccgaaaccccggtcaagctcgctgcctctctcaagcccag
catcctcttcgggatgctgagcgccccggctgcggctcccgctgtcgcggccccggccgc
cgccccagtcacccccacccctgtattcaagcccatttttggagcccctcccaaaagcga
gagcgggaccccgttggccgccggctcctccgccctggcgcctgctggcgcggcccccgc
cccctccacccccaatttcaagcccatctttggggacgtggggccccccgctgctgggcc
cttggcgggagtggcgtccccctttgccttcaagcagacgcccccgccggccccggcccc
cgcggtgaccagcgcggcccagctcttcgccgcggccgagagcaaacctgtctttggagg
tacctccgctcccgccttcggtcagagcgcgccaacccccggagctggcaccgcgggcag
caccctgaccttcgggacccccgccaccccgacccaaggcttcgtgggaaccggacctac
cttcgcgccctcctgccgctag

DBGET integrated database retrieval system