KEGG   Ornithorhynchus anatinus (platypus): 100083997Help
Entry
100083997         CDS       T01045                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:oaa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 271 aa AA seqDB search
MPPPSEPERVARNGIYLTQFTRTRQLVPFRGTTKQRAPNLLFRHGFLRACAPARKIADFP
PPTGVIFLHGLGDTGHGWAQAFAGIKSSHIKYICPHAPIMPVSLNMNMAMPSWFDIIGLS
PDAQEDDTGIKQAAENIKALIDQEVKNGIPSDRIVVGGFSQGGALSLYTALTTHQKLAGV
VALSCWLPLRSSFQQGPISGVNKDISILQCHGECDPLVPLMFGSLTVEKLKTLVNPANVN
FKTYGGMVHSSCSQEMMDVKQFIDKLLPPVG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgccgtcggagcctgagcgggtggccagaaacggcatctatttgactcagttt
accagaacaagacaactagtaccgtttcgggggacgacaaaacagcgagccccaaattta
ctatttcggcatgggtttctgagagcttgtgccccggccagaaaaattgccgactttcca
cccccaacgggcgttattttccttcacggattgggagataccgggcatggctgggcacaa
gcctttgcaggtatcaaaagttctcacatcaaatatatatgtccccatgcgcctattatg
cccgtttccctaaatatgaacatggccatgccatcttggtttgatattattggactctct
ccagatgcacaggaagatgatactggaatcaagcaggcagcagagaatatcaaagctttg
atagaccaagaagtgaagaatggaattccttcagatagaattgttgtgggaggattttct
cagggaggagctctgtcgttgtatactgctttgacaactcaccagaaattggcaggtgtg
gtagccctgagttgttggcttcctcttcgatcttcatttcaacagggtcccatcagtggg
gtcaacaaagatatttccatccttcagtgtcatggagaatgcgatcctttagttccgctc
atgtttggttctctcaccgtcgaaaagctaaagactttggtaaatccagctaatgtaaat
ttcaagacctacggcggcatggtgcatagttcgtgcagtcaggaaatgatggacgtcaag
caattcattgataaactcctacctccggttggttaa

DBGET integrated database retrieval system