KEGG   Ornithorhynchus anatinus (platypus): 100083997Help
Entry
100083997         CDS       T01045                                 

Gene name
LYPLA1
Definition
lysophospholipase I
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycerophospholipid metabolism
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100083997 (LYPLA1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100083997 (LYPLA1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100083997 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 172 aa AA seqDB search
MPVSLNMNMAMPSWFDIIGLSPDAQEDDTGIKQAAENIKALIDQEVKNGIPSDRIVVGGF
SQGGALSLYTALTTHQKLAGVVALSCWLPLRSSFQQGPISGVNKDISILQCHGECDPLVP
LMFGSLTVEKLKTLVNPANVNFKTYGGMVHSSCSQEMMDVKQFIDKLLPPVG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtttccctaaatatgaacatggccatgccatcttggtttgatattattggactc
tctccagatgcacaggaagatgatactggaatcaagcaggcagcagagaatatcaaagct
ttgatagaccaagaagtgaagaatggaattccttcagatagaattgttgtgggaggattt
tctcagggaggagctctgtcgttgtatactgctttgacaactcaccagaaattggcaggt
gtggtagccctgagttgttggcttcctcttcgatcttcatttcaacagggtcccatcagt
ggggtcaacaaagatatttccatccttcagtgtcatggagaatgcgatcctttagttccg
ctcatgtttggttctctcaccgtcgaaaagctaaagactttggtaaatccagctaatgta
aatttcaagacctacggcggcatggtgcatagttcgtgcagtcaggaaatgatggacgtc
aagcaattcattgataaactcctacctccggttggttaa

DBGET integrated database retrieval system