KEGG   Ornithorhynchus anatinus (platypus): 100084173Help
Entry
100084173         CDS       T01045                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
HIF-1 signaling pathway
Class
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:oaa04066]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 428 aa AA seqDB search
MFGIVQCVLTNFWFALEECESLVCLEPAEFQNAGKWESSLRFPKLAKQFKGKWKHLAGSV
NACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKS
AEDSKTIYDFTDTVITIRNRHNDVIPTMAQGVVEYKESFGVDPVTSQNVQYFLDRFYMSR
ISIRMLLNQHSLLFGGKNKGSTAHRKHIGSINPNCNVVEVIKDGYENARSLCDLYYINSP
ELKLVELNAKSPGQPMQVVYVPSHLYHMVFELFKNAMRATMEHHADKGVYPPIHVHVTLG
NEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQY
FQGDLKLYSLEGYGTDAVIYIKALSTESVERLPVYNKSAWKHYKTNHEADDWCVPSSEPK
DMTTFRSA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtttggaattgtacagtgtgtcctaaccaacttttggttcgccctggaggagtgtgaa
tcactggtgtgtttggagccggctgaattccaaaatgcaggcaagtgggaaagcagtctc
aggtttccaaagctggcaaagcagttcaagggcaaatggaagcatttagctggatctgtg
aatgcttgtgaaaagacttcatttatgtttctgcgtcaagagttgcctgtaagattggca
aatataatgaaagaaataagtctgcttcctgacaaccttctccgaacaccttcagtgcaa
ctggtgcagagctggtacatccaaagtcttcaggagcttcttgattttaaggacaagagt
gctgaagattctaaaactatttatgattttacagatactgtgataacaatcagaaatcga
cacaatgatgtcattcctaccatggcccagggtgtggttgaatacaaggaaagctttggt
gtggatccagtgaccagtcagaatgtgcagtattttttagatcgtttctacatgagtcgc
atatcaattagaatgctgctcaatcagcactctttactatttggtggaaaaaataaagga
agtacagctcaccgcaaacacattggaagcattaatccgaactgcaatgttgttgaagtt
attaaagatggctatgaaaatgcaaggagtctgtgtgatttatattatatcaactctcct
gaattgaagctcgtagagctaaatgccaaatcaccaggacagcccatgcaagtggtatat
gtgccatcccatctctatcacatggtgttcgaactttttaagaatgcaatgcgagctacc
atggagcaccatgctgacaaaggggtttacccccctatccatgttcatgtcacactgggg
aacgaggacttgactgtgaagatgagtgatcgtggaggtggggttcctctgaggaaaatt
gacaggctcttcaactacatgtattcaactgcacctcgacctcgcgttgaaacatcccga
gctgtgcccctggctggttttggatatggtttgcccatatcacgtctttatgcacagtac
ttccaaggagacctgaaactctattccttagagggatatggtacagatgcagttatctac
attaaggccctgtcgacagaatcggtggagagacttcctgtgtataacaaatccgcttgg
aaacattataaaaccaatcacgaagcagatgattggtgtgtgccaagcagtgaaccaaag
gacatgaccacatttcgcagtgcatag

DBGET integrated database retrieval system