KEGG   Ornithorhynchus anatinus (platypus): 100084405Help
Entry
100084405         CDS       T01045                                 

Gene name
GLB1
Definition
(RefSeq) galactosidase beta 1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00052  Galactose metabolism
oaa00511  Other glycan degradation
oaa00531  Glycosaminoglycan degradation
oaa00600  Sphingolipid metabolism
oaa00604  Glycosphingolipid biosynthesis - ganglio series
oaa01100  Metabolic pathways
oaa04142  Lysosome
Module
oaa_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100084405 (GLB1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    100084405 (GLB1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100084405 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100084405 (GLB1)
   00511 Other glycan degradation
    100084405 (GLB1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100084405 (GLB1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100084405 (GLB1)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100084405 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 100084405
NCBI-ProteinID: XP_007655960
Position
Un
AA seq 528 aa AA seqDB search
MPSFGLAALLLLLLPAVGEGRGDPNPPQRTFAIDYKRDCFLKDGKPFRYISGSVHYSRVP
RFYWKDRLLKMKLAGLNAIQTLHRRCGEVDGCPFAQDEAVTLSKWRAHHHSTGINITAAF
ETQRKSEPRGPLVNSEFYTGWLDHWGQPHSQVGIQVIVKSLQDMLARGANVNLYMFLGGT
NFGYWNGANTPYMPQPTSYDYDAPLSEAGDLTEKYFAVREVIGMYEHIPDDPIPPTTPKF
AYGKVVLRKLNTVVELLEVLCPPGPVKSKYPLTFVQVKQYFGFVLYRTTLPRNCEQVPLS
SPFNGVHDRAYVTVEGVLQGILERDKSITINVTGKAGANLDLLVENMGRVNFGRYNNDFK
GLVSNLTLGQDVLTDWMVFPLGIDEAVQGDLAHGGAGVKTARSRSADLGVPTFYVGQLSI
PSGIPDLPQDTYLKFPGWTKGQVWINGFNLGRYWPVRGPQETLFVPRNILVTSAPNNITV
LELERAPCAASEKCAVEFVDTPLLNATLAYESRHQERMFSRGSWQDHL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcccagctttgggctggcggcgctgctgctgctgctgctgccggcggtgggcgagggc
cgaggagatccgaaccctccccagcggacgtttgccatcgactacaagagagactgcttc
ctcaaggatgggaaaccatttcgctacatctcggggagcgttcactactcacgggtgccc
cgcttctattggaaggatcgtcttctgaagatgaagctggcggggcttaatgctattcaa
acattacatcgccgctgtggagaagtggatgggtgtccttttgcccaagatgaagccgtt
actctatcaaaatggagggcccatcatcacagtacaggtatcaacattacagctgccttt
gaaacccagagaaagagtgagcccaggggtcctttggtgaattccgagttctacactggc
tggttggatcactggggccaaccacactcacaggttggaatccaagtcatagtgaaatcc
cttcaagatatgctcgctcgtggagctaatgtgaacttgtacatgtttctaggtgggacc
aattttggctactggaatggtgccaacacgccctacatgccccagcccaccagctacgat
tacgacgcgccgttgagtgaagccggggatctgaccgagaaatactttgccgtgagggaa
gtaatcgggatgtatgagcacataccagatgatcccatcccaccaaccacacctaaattt
gcatatggaaaagttgtcctgcggaagttaaacacagtggtggagcttcttgaagttctt
tgtcctcctgggccagtgaaaagcaagtatcccttgacatttgtccaagtgaaacagtat
tttggatttgtactatatcgaaccacattgcctagaaactgtgaacaggtgccgctttct
tcccccttcaatggagtccatgaccgagcttacgtgactgtggaaggggtcttgcaagga
atccttgagagagacaagtcgattactataaatgtaactgggaaagctggcgctaatttg
gaccttctggtagaaaacatggggcgagtgaactttgggagatataacaatgactttaag
ggtctggtgtccaacctaaccctcggccaggacgtcctcacagactggatggtcttccct
cttggcatcgacgaggccgtacagggggacctcgcccacggtggtgcgggagtgaagacg
gccaggagccggtcggccgacctgggggtccccactttctacgttgggcagttgtccatt
cccagcggaatcccagacttacctcaggacacctacctcaagtttccgggttggaccaag
ggccaggtttggatcaacggcttcaatctcggccgctactggccggtccgaggtccccag
gagacgttattcgtcccgagaaacatcctggtgacgtcggcgccaaacaacatcacggtg
ctggaattggagcgggctccgtgtgctgcctcagagaagtgcgccgtggaatttgtggac
acgccacttctcaacgcaaccctcgcctatgagagtcgtcatcaggagaggatgtttagt
agaggatcgtggcaggaccatttataa

DBGET integrated database retrieval system