KEGG   Ornithorhynchus anatinus (platypus): 100084405Help
Entry
100084405         CDS       T01045                                 

Gene name
GLB1
Definition
galactosidase, beta 1
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100084405 (GLB1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    100084405 (GLB1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100084405 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100084405 (GLB1)
   00511 Other glycan degradation
    100084405 (GLB1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100084405 (GLB1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100084405 (GLB1)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100084405 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 528 aa AA seqDB search
MPSFGLAALLLLLLPAVGEGRGDPNPPQRTFAIDYKRDCFLKDGKPFRYISGSVHYSRVP
RFYWKDRLLKMKLAGLNAIQTLHRRCGEVDGCPFAQDEAVTLSKWRAHHHSTGINITAAF
ETQRKSEPRGPLVNSEFYTGWLDHWGQPHSQVGIQVIVKSLQDMLARGANVNLYMFLGGT
NFGYWNGANTPYMPQPTSYDYDAPLSEAGDLTEKYFAVREVIGMYEHIPDDPIPPTTPKF
AYGKVVLRKLNTVVELLEVLCPPGPVKSKYPLTFVQVKQYFGFVLYRTTLPRNCEQVPLS
SPFNGVHDRAYVTVEGVLQGILERDKSITINVTGKAGANLDLLVENMGRVNFGRYNNDFK
GLVSNLTLGQDVLTDWMVFPLGIDEAVQGDLAHGGAGVKTARSRSADLGVPTFYVGQLSI
PSGIPDLPQDTYLKFPGWTKGQVWINGFNLGRYWPVRGPQETLFVPRNILVTSAPNNITV
LELERAPCAASEKCAVEFVDTPLLNATLAYESRHQERMFSRGSWQDHL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcccagctttgggctggcggcgctgctgctgctgctgctgccggcggtgggcgagggc
cgaggagatccgaaccctccccagcggacgtttgccatcgactacaagagagactgcttc
ctcaaggatgggaaaccatttcgctacatctcggggagcgttcactactcacgggtgccc
cgcttctattggaaggatcgtcttctgaagatgaagctggcggggcttaatgctattcaa
acattacatcgccgctgtggagaagtggatgggtgtccttttgcccaagatgaagccgtt
actctatcaaaatggagggcccatcatcacagtacaggtatcaacattacagctgccttt
gaaacccagagaaagagtgagcccaggggtcctttggtgaattccgagttctacactggc
tggttggatcactggggccaaccacactcacaggttggaatccaagtcatagtgaaatcc
cttcaagatatgctcgctcgtggagctaatgtgaacttgtacatgtttctaggtgggacc
aattttggctactggaatggtgccaacacgccctacatgccccagcccaccagctacgat
tacgacgcgccgttgagtgaagccggggatctgaccgagaaatactttgccgtgagggaa
gtaatcgggatgtatgagcacataccagatgatcccatcccaccaaccacacctaaattt
gcatatggaaaagttgtcctgcggaagttaaacacagtggtggagcttcttgaagttctt
tgtcctcctgggccagtgaaaagcaagtatcccttgacatttgtccaagtgaaacagtat
tttggatttgtactatatcgaaccacattgcctagaaactgtgaacaggtgccgctttct
tcccccttcaatggagtccatgaccgagcttacgtgactgtggaaggggtcttgcaagga
atccttgagagagacaagtcgattactataaatgtaactgggaaagctggcgctaatttg
gaccttctggtagaaaacatggggcgagtgaactttgggagatataacaatgactttaag
ggtctggtgtccaacctaaccctcggccaggacgtcctcacagactggatggtcttccct
cttggcatcgacgaggccgtacagggggacctcgcccacggtggtgcgggagtgaagacg
gccaggagccggtcggccgacctgggggtccccactttctacgttgggcagttgtccatt
cccagcggaatcccagacttacctcaggacacctacctcaagtttccgggttggaccaag
ggccaggtttggatcaacggcttcaatctcggccgctactggccggtccgaggtccccag
gagacgttattcgtcccgagaaacatcctggtgacgtcggcgccaaacaacatcacggtg
ctggaattggagcgggctccgtgtgctgcctcagagaagtgcgccgtggaatttgtggac
acgccacttctcaacgcaaccctcgcctatgagagtcgtcatcaggagaggatgtttagt
agaggatcgtggcaggaccatttataa

DBGET integrated database retrieval system