KEGG   Ornithorhynchus anatinus (platypus): 100084448Help
Entry
100084448         CDS       T01045                                 

Gene name
ADRA2B
Definition
alpha-2B adrenergic receptor
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100084448 (ADRA2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100084448 (ADRA2B)
G protein-coupled receptors [BR:oaa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100084448 (ADRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 209 aa AA seqDB search
RAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRHTWCEVYLALDVLFCTSSIVHL
CAISLDRYWSVSRALEYNSKRTPRRIKAAILTVWLIAAFISLPPLVYKGDKGPRVPGRPQ
CKLNDEAWYILASSIGSFFAPCLIMILVYLRIYFIAKRRNRPGPRAGRPPADGPPAHGPP
GAGSDGAPGTGSDGAPGAGSDGTAPNGHQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
cgggccccccagaacctgttcctggtgtcgctggccgcggccgacatcctggtggccacg
ctcatcatccccttctcgctggccaacgagctgctgggctactggtacttccgacacacc
tggtgcgaggtgtacctggcgctggacgtgctcttctgcacctcgtccatcgtgcacctg
tgcgccatcagcctggaccgctactggtcggtcagccgggccctggagtacaactccaag
cggaccccgcggcggatcaaggccgccatcctcaccgtctggctcatcgcggccttcatc
tcgctgcccccgctcgtctacaagggggacaagggcccgcgggtgcccggccggccgcag
tgcaagctcaacgacgaggcctggtacatcctggcgtccagcatcggctccttcttcgcc
ccctgcctcatcatgatcctcgtctacctgcgcatctacttcatcgccaagcgccgcaac
cggcccggcccgcgggccgggcggcctcccgccgacgggccccccgcccacgggcccccc
ggggcgggctcggacggggcccccgggaccggctcggacggggcccccggggccggctca
gacgggactgcccctaacgggcaccaa

DBGET integrated database retrieval system