KEGG   Ornithorhynchus anatinus (platypus): 100084462Help
Entry
100084462         CDS       T01045                                 

Gene name
FLNB
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100084462 (FLNB)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100084462 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100084462 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    100084462 (FLNB)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100084462 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2399 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
HMYRKYHQRPTFRQMQLENVSVALEFLERESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPSKPVDNAREAMQQADDWLGVPQVITPEEIIHPNVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQLARFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKSKTYSVQYMPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGVETSGVIANKPTYFDIYTAGAGVGDLGVEVEDPQGKKNIEMLIEDKGNQVFRCAYKP
THPGLHVVKVSFAGELIPKSPFSVNVGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGEVKVIVKGPKGLEELVKQKDFMDGVYAFGYYPGIPGKYVVIITWGGHNIPKSPFE
VQVGPEAGVQKVRAWGPGLHGGVVGKSADFVVESIGTEVGSLGFAIEGPSQAKIECEDQN
DGSCDVKYWPREPGEYAVHIMCDDEDIKNSPYMALIQPTSEDFSPDLVKAYGRGLEKTGC
IVNDPAEFTVDTKAAGKAPLKIYAQDGEGNSIDVHILNKMDGIYTCSYTPLKPIKHTFAI
VWGEVDIPNSPFRVVIGQGSHPQRVRVFGPGVERTGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYMPPASGRYTIKVLFASQEIPASPFHVKID
PSHDANKVKAEGPGLSKAGVENGKPTHFTVFTKGAGKAPLDVQFNGPLPGEAVKDLDIID
NYDYSHTVKYTPLQQGNTQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGK
DQEFTVDIKGAGGQGKVDVTILTPGRKVLPCLMEPVVGKDCSTAKYIPKEEGLYVVDVSY
DGNPVPGSPYNVEASLPPDPTKVRAHGSGLRGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVAYLPTKPGDYFVNILFEDVHIPGSPFQADIEMPFNASKVIATG
PGLECGKVGEAGLLNVDCSEAGPGDLGLEAISDSGAKAQVQVEDNKDGTYAVTYLPLSAG
MYTLMMKYGGEQVPKFPARVKVEPAVDTSKIRAFGPGIEGKDVFREATTNFTVDARSLTK
VGGDHIKALVTSPSGASTNCPIEDHADGTYSAEYTPFEKGPHIVEVTYDNVPVAQSPFKV
GVTEGCHSSRVKTHGPGLKEAFTNKPNGFSVVTRGAGIGGLGITVEGPSESKISCKDNKD
GSCSAEYIPFAPGDYDVNITYGGEHIPGSPFRVPVKDVVDSSKIKVAGPGITTGVRARIR
QSFTVDSSKAGFAPLEVRVVGPRGLIDPVNVMDNGNGTHTITYTPSQEGPYTISVKYADE
EIPRSPFKIKVLPTYDASKVTANGPGLSSYGVPASLPVDFAIDAKDAGEGLLAVQITDQE
GKLKRADIHDNKDGTFSVTYIPDKTGRYVIGVTYGGDEIPASPYRIRATPTGDASKCMAT
GPGIASTVKTGEELGFVVDAKTAGKGKVTCTVLTPDGTETEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMAADDEVAVMEEAPVTEEAYVPGSDVNGLGFKPFDMVI
PFAVRKGEITGEVHMPSGKTASPEIVDNKDGTVTVRYAPVEVGLHEMHIKYIGNHIPESP
LQFYVNYPNSGSVSAFGPGLVYGVANKTSTFTIVTEDAGEGGLDLAIEGPSKAEISCIDN
KDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDIQ
ETDLSTLTASIKAPSGHDEPCLLKRLPNNHIGISFIPHEVGQHVVSIKKNGSHVPNSPVS
IMVVQSEIGDARRAKVSGQGLTEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTED
LEDGTCKVSYFPTVPGIYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATI
GSICDLNLKIPEIDSGEMSAQVTSPSGRITEAEIVPMGKSSHCVRFIPEEMGVHTVAARY
QNRHVPGSPFQFTVGPLGEGGAQNVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVE
GPSKAEIAFDDHKNGSCGVSYIAQEPGDYEVSVKFNDEHIPDSPYLVPVIAPSDDARRLT
VMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHE
NGVHTIDVKFNGSHVVGSPFKVRVGEPGQGGNPTLVSAYGAGLEGGTTGKQLHAIQSCR
NT seq 7200 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgaccgagaaagacctagccgaggacgcgccctggaagaagatccagcaaaac
acctttactcgctggtgtaacgagcatctgaaatgcgtgaacaaacgcatcgggaacctg
cagaccgaccttagcgacgggctgcgattgatcgcgctgctcgaggtcctgagccagaag
catatgtaccgcaagtaccaccagcggcccaccttccgtcagatgcagttggagaatgtg
tcggtggcgctcgagttcctggaacgggagagcatcaagcttgtgtctatcgatagcaaa
gccattgttgatgggaatttgaagcttatcctcggcctagtatggacccttatccttcac
tactccatttcgatgcctgtgtgggaggatgaaggagatgatgatgctaagaaacaaact
ccgaagcagaggctgttgggatggattcagaacaaaattccatacttgcccatcacaaac
ttcaaccagaactggcaagatggtaaagcactgggagctcttgtggacagctgtgctcca
ggtctttgccctgactgggagtcttgggatcctagcaagccagtagataatgcccgggaa
gccatgcagcaggctgatgactggctgggagtcccacaggttatcactcctgaagaaatt
atccaccctaatgtcgatgaacactctgtaatgacttacttgtcacaatttcccaaagcc
aaactcaaaccaggagctcctctgaaacccaaactcaacccaaagaaagccagggcctat
ggcagaggcattgaacccactggaaacatggtgaaacagcttgccagatttacggtggac
actatcagtgctggacaaggagacgttatggtttttgtggaagacccagaaggcaacaaa
gaagaggcacaggtgactcctgacagtgacaagagcaaaacttactctgtacagtatatg
cccaaggttactgggcttcacaaggtcatagttctctttgctggacagcatatctccaag
agtccatttgaagtgaatgttgacaaagcccagggagatgctagtaaagtaacagcgaaa
gggccaggtgtggaaacttcaggggtcattgctaacaagccaacgtactttgatatatac
acagcgggagctggtgtaggtgaccttggagtggaagtggaggatcctcaaggaaagaag
aacatagaaatgctcatagaagacaagggaaaccaggtcttccgctgtgcctacaaacca
actcatcctggactccatgttgttaaagtctcatttgctggggagttgattcctaaaagc
cctttctctgttaatgttggagaagcttgcaatccaaatgcctgccgtgccagtggccga
ggtttgcaacctaagggagtccggatcagagagactgcagattttaaggttgacacaaaa
gctgcgggaagtggagaagtcaaagtaattgtcaaaggacccaagggcctggaagagctt
gtgaagcagaaggactttatggatggtgtatatgcctttgggtactatccaggaattcca
ggaaaatatgtggttatcatcacatggggaggacataacatacctaagagcccttttgaa
gttcaagtgggtccagaggctggtgttcagaaagtaagagcctggggcccaggtctccat
ggtggtgttgttgggaagtcagctgattttgtggtggagtccattggaaccgaagtggga
tctctaggatttgcaattgaaggcccatctcaagccaaaattgaatgtgaagatcaaaac
gatggctcctgtgatgtgaaatattggcccagagaacctggtgaatatgcagttcatatc
atgtgtgatgatgaagacataaagaacagcccatacatggctcttatccaaccgacctct
gaagacttcagtccagatttggtcaaagcttatggtcgaggattagagaagactggctgc
attgtcaatgatcctgctgagttcacagtggataccaaagctgctgggaaagctcctttg
aagatatatgcacaggatggagaaggaaattctattgacgttcacatattgaacaagatg
gatggaatttatacctgttcttacactccgctgaagccaatcaagcatacctttgcaatt
gtttggggtgaagtagatatccccaatagcccattcagagttgtcattggacaagggagc
caccctcagagagtcagagtgtttgggcctggtgtggagagaactggtctgaaagcaaat
gagccaactcacttcacagtggactgcacagaggcaggagaaggtgatgtcagcgttggc
attaagtgtgatgccagagtgttgagtgaggatgaggaagatgtggattttgacattatt
cacaacgccaatgatacatttacagtgaaatacatgccaccagcttctgggcgatatact
atcaaagtgctctttgcttcccaggaaattcctgccagccctttccacgtcaagattgat
ccttcacatgatgcaaacaaagtgaaagctgaaggacctgggctaagtaaagcaggtgtg
gaaaatggaaaaccaactcacttcacagtcttcacgaaaggggctggaaaagcaccactg
gacgttcagttcaatggccctctccctggggaggcggtgaaagatttggatattattgat
aactatgactattctcacacagttaaatacacccctctccaacagggtaacacacaagtt
ttggtgacttatggtggtgatcctattcctaaaagccctttcactgtgggagttgccgct
ccgttggatctgagcaagataaaaatcaatggactggaaaacagagtggaagtgggtaaa
gatcaggagttcacggttgatatcaaaggagctggaggacaagggaaagtggatgtaact
attttaactcctggaaggaaggtgttgccatgcctaatggagcctgttgtgggtaaagac
tgtagtactgcaaaatacatcccaaaggaggaaggactttatgtggttgatgtgagctat
gatggaaatccagtcccaggaagtccttataatgtggaagcctctctaccacctgatccc
acaaaggtgagagcccatggctctggtcttcgaggtggtctggttgggaagcctgcagag
tttactattgacactaaaggagcgggaactggtggtttgggcctgactgtagaaggtcca
tgtgaagccaagattgaatgctcagataacggggatgggacctgttctgttgcttacctt
ccgacaaagcctggtgattattttgttaatattctcttcgaagatgttcacattccgggt
tctccatttcaagcagacattgaaatgccatttaatgcctctaaagtcattgccacagga
ccagggcttgaatgtgggaaagtaggtgaagctggtttgcttaatgtggactgctcagaa
gcaggccctggggacttgggtttggaagcaatatcagattctggtgctaaagctcaagtc
caggttgaagataacaaagatggaacttatgcggttacctatctacccctgtctgctgga
atgtatacactaatgatgaaatacggaggagaacaagtgccaaagttccctgcccgggtc
aaagttgaaccagctgtggataccagcaaaataagagcttttggaccaggaatagaagga
aaagacgttttccgcgaagccacaactaacttcacagtagatgcccgttccttgacaaaa
gtaggaggagatcatatcaaagcacttgtcaccagtccctctggagcttccactaactgt
ccaattgaagaccatgctgatggaacttacagtgcagagtacactccatttgaaaaaggc
ccccatatagtagaggtaacatacgataatgtaccggttgcacagagccctttcaaagtg
ggggttactgaaggttgccattcatcgagggttaaaacccatggtcctggtttgaaagaa
gctttcacaaataaaccaaatggattcagtgtggtgacaagaggagcaggaattggtgga
cttggcataactgttgagggaccatctgagtcaaagataagttgcaaagataataaagac
ggcagctgcagtgctgaatatattccatttgctccaggagactacgatgttaatatcacg
tatggaggagaacacatacctggtagcccattcagggttcccgtgaaagatgtggtcgac
tccagcaaaataaaggttgccggtccaggtataaccacaggagtgagagccagaatccga
caatcttttacagtggacagtagcaaagctgggtttgcccctcttgaggttcgggtagtg
gggcctagaggcctgatagatcctgtgaatgtgatggacaatggaaatggtacacatact
ataacatataccccttcccaagaaggaccttacacaatctctgttaaatatgctgatgaa
gagatcccccgcagtcccttcaagattaaagtccttcctacatatgatgctagtaaagtg
accgctaatggacctggcctcagttcctatggtgtgccagccagtttgcctgtggatttt
gcaatcgatgctaaagatgcaggtgaagggctcctcgctgtacagatcactgatcaagaa
ggaaaactaaagagagcggatattcatgacaacaaagatggcactttctcagtaacctat
atcccggataagacaggccgctatgtgattggggttacttatggaggtgatgagatccca
gcatctccttaccgaatccgggccacaccaacaggtgatgccagcaaatgcatggccaca
ggtcctggaattgcatccactgtaaaaaccggtgaagagcttggtttcgtggttgatgcc
aagactgctgggaaaggtaaagtgacatgtactgttctgaccccggatggcacagaaact
gaagcggatgttattgaaaacgaggatgggacgtatgatattttctacactgctgcaaag
ccgggaacctatgttatctatgttcgctttgggggagtggatattcccaacagcccattc
accgtcatggctgcagatgatgaagttgcagttatggaggaggcaccggtgactgaagaa
gcttatgtcccaggcagtgacgtgaatggcttaggatttaaaccttttgatatggtcatt
ccatttgcagtaaggaaaggagaaataactggtgaagtccacatgccttctggaaagact
gctagcccagaaattgtggacaacaaagatggtacagtgactgttagatatgctcctgtt
gaggttgggctgcatgagatgcacatcaaatatattggtaatcacatcccggagagcccc
ctccagttctacgtcaactacccaaacagtggaagtgtatctgcttttggtcctggtctc
gtgtatggtgtggctaacaaaacctccaccttcaccatagtcacagaagatgcaggagag
ggtggacttgacttggctattgaaggaccttccaaagcagagattagttgcattgataac
aaggatggcacctgcacggtgacctatctgccgacccttccgggtgactacagcatactg
gtcaagtacaatgacaagcacattcctggcagcccattcacagccaagatcacagatgac
agcaggagatgttcccaggtgaagctaggctctgctgctgatttcctgcttgatatccaa
gaaactgatcttagcacgttgacagccagtattaaggccccgtctggccatgatgagcct
tgcctcctaaagagactacctaataaccatattggcatttcattcatcccacatgaagtg
ggtcagcacgtagtcagcattaagaagaatggcagccatgtgcccaatagtcctgtgtcc
atcatggtggttcagtcagaaattggagatgcccgtagagctaaagtctcaggccagggc
ttgactgaagggcgtacttttgagatgtcagatttcatcgttgatacaagagatgcaggg
tatggtggcatatctctagcagttgaggggcccagcaaagtcgacattcaaacagaagat
ctggaggatggaacctgcaaggtgtcatacttcccaacggtaccgggtatttatattgtg
tctaccaaatttgcggatgaacatgtgccaggtagcccatttacggtgaaaataagtgga
gaaggaagggtcaaggagagcatcactcgcacaagccgggctccctctgtagcaacaatt
gggagtatatgtgatcttaatctgaaaattccagaaattgatagcggggagatgtctgct
caggtcaccagcccctctggcagaataacagaagcagaaatagttcccatgggaaagagc
tctcattgtgttcgtttcatcccggaagagatgggcgttcatacagtggctgcaagatac
cagaaccggcatgttccaggcagcccatttcagttcacagttggacctcttggtgagggg
ggtgctcagaatgtccgagctggagggccaggccttgagagaggagaagcaggagtacca
gctgaattcagcatatggaccagagaagcaggagccggaggcctttccattgccgttgaa
ggaccaagtaaagcagaaattgcatttgatgaccataaaaatggatcttgtggtgtgtct
tacattgcacaagagcctggtgactatgaggtgtcagtcaagttcaatgatgaacacatt
ccagacagcccttacttggttccagttatcgctccttcagacgatgctcgcagactcact
gttatgagccttcaggagtctggattaaaagttaaccagccagcatcctttgctataaga
ctgaatggagcaaagggcaaaattgatgcaaaagttcacagcccctctggagcagtggaa
gaatgccatgtttccgagttggagccagacaagtatgcagttcgctttatcccacatgaa
aatggagttcacacaattgatgtgaagttcaatgggagccatgttgtgggaagcccattt
aaagttcgagttggggaaccaggacaaggaggaaatccaactcttgtctctgcatatgga
gctggcctagaagggggcaccacaggtaaacaactccatgcaatacaaagctgccggtag

DBGET integrated database retrieval system