KEGG   Ornithorhynchus anatinus (platypus): 100084553Help
Entry
100084553         CDS       T01045                                 

Gene name
KAT2A
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100084553 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100084553 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100084553 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    100084553 (KAT2A)
Enzymes [BR:oaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100084553 (KAT2A)
Transcription machinery [BR:oaa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100084553 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 691 aa AA seqDB search
VSRRLGGAGEPLQPPPLSPHSADHVSHLENVSEDEISRLLGMVVDVENLFMSVHKEEDTD
PKQVYFLPLLRKCILQITRAVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMY
ELSKMFLLCLNYWKLETPAQFRQRSQAEDVAAYKVNYTSRGLLKSIFTVTRRQLLEKFRV
EKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWAAGFTLPAAEGTQLGPQPAAVSAT
AVPTTPLFSSSLGGGSSNGGCAGSSLSARDTGAAETFASLSVGPGEKRKPQDSLTLEDAK
RLRVTGDIPMELVNEVMLTVTDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGN
SLAPKASRRLLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFR
MFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHGILFFLTYADEYAIGYFKKQG
FSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQI
RRVYPGLSCFKEGVRQIPVESIPGLRETGWKSLGKEKGKELKDPDQLYTTLKNLLAQIKT
HPSAWPFMEPVKKAEAPDYYEVIRFPIDLKTMTERLRARYYVTKKLFVADLQRVIANCRE
YNPPDSAYCRCANTLEKFFYFKLKEGGLIDK
NT seq 2077 nt NT seq  +upstreamnt  +downstreamnt
ggtgtctcggaggctggggggagcgggggagcccctccaacctccgcctctctccccaca
ctcagctgaccacgtgtcccacttggagaacgtctccgaggacgagatcagccggctgct
gggcatggtggtcgacgtggagaacctgtttatgtctgtgcacaaggaagaggacactga
ccccaagcaggtgtacttcttacctctcctgcgcaagtgcatcctgcagatcactagggc
cgtggtggagggctccttgggaagcccccccttcgagaagcccaacatcgagcagggcgt
cctgaatttcgtccagtacaagttcagccacctggcccccaaggagcggcagacgatgta
cgagctgtccaagatgttcctgctgtgcctcaactactggaaactggagacgcccgccca
gttccgccagcgctcgcaggccgaggacgtggccgcctacaaggtcaactacaccagccg
cggcctcctcaagtccatcttcaccgtgacgcggcgccagctcctggagaagttccgcgt
ggagaaggacaagctggtgcccgagaagaggacgctgatcctcacccacttccccaagtt
cctgtcgatgctggaggaggagatctatggcgagaactcacccatctgggcagccggttt
taccttgcccgcggcggaggggactcagcttgggccccagccagccgccgttagcgccac
ggccgtgcccaccaccccgctcttcagctccagcctgggaggcggcagcagcaacggcgg
ctgcgccggcagctccctgagtgcccgggacactggcgccgctgaaacctttgccagcct
gtctgtcggtccaggcgagaaacggaagccgcaggacagcctgaccctggaagatgccaa
gcggctgcgggtgacgggcgacattcccatggagctggttaacgaggtcatgctgaccgt
caccgacccggccgccatgctgggccccgagaccagcctgctgtcggccaacgcggcgcg
ggacgagacggcgcggctggaggagcggcgtggcatcatcgagttccacgtgatcgggaa
ctcgctggcccccaaggccagtcggcgactgctgctctggctggtcggcctgcagaacgt
cttctcccaccagctgccccgtatgcccaaggagtacatcgcccgcctcgtctttgaccc
gaagcacaagacgctggctctgatcaaggacggccgggtcatcggggggatctgcttccg
catgttccccacccagggcttcaccgagattgtcttctgtgccgtcacctccaatgagca
agtcaagggctacgggacgcacctgatgaaccacctgaaggaatatcacatcaaacacgg
gatcctgttcttcctcacttacgctgatgagtacgccattggctacttcaagaagcaggg
cttttccaaagacatcaaggtgcccaagagccgctacctgggctacatcaaggactatga
gggggccaccctgatggagtgcgagctgaatcctcgcattccctacaccgagctgtccca
catcatcaagaagcagaaggagatcatcaagaagctaatcgagcgaaagcaggctcagat
ccggcgtgtctaccccgggctcagctgcttcaaggaaggcgtccggcagatccccgtcga
gagcatccccggcttgcgagagacaggctggaagtcccttgggaaggagaaggggaagga
actgaaagatccagaccagctgtatacaacgctcaagaatctgctggcccagattaagac
gcaccccagtgcctggcccttcatggagcccgtgaagaaggccgaagcgccagactatta
cgaggttattcgcttccccatcgatctgaagaccatgacggagaggctccgagcccgcta
ctacgtgaccaagaagctgttcgtggcggacctgcagcgggtcatcgccaactgccgaga
atacaacccgcccgacagtgcctactgccgctgtgccaacaccctggagaagttcttcta
cttcaagctcaaggagggagggctcatcgacaagtga

DBGET integrated database retrieval system