KEGG   Ornithorhynchus anatinus (platypus): 100084645Help
Entry
100084645         CDS       T01045                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa01522  Endocrine resistance
oaa04010  MAPK signaling pathway
oaa04012  ErbB signaling pathway
oaa04014  Ras signaling pathway
oaa04062  Chemokine signaling pathway
oaa04068  FoxO signaling pathway
oaa04072  Phospholipase D signaling pathway
oaa04150  mTOR signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04510  Focal adhesion
oaa04540  Gap junction
oaa04630  Jak-STAT signaling pathway
oaa04650  Natural killer cell mediated cytotoxicity
oaa04660  T cell receptor signaling pathway
oaa04662  B cell receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04714  Thermogenesis
oaa04722  Neurotrophin signaling pathway
oaa04810  Regulation of actin cytoskeleton
oaa04910  Insulin signaling pathway
oaa04912  GnRH signaling pathway
oaa04915  Estrogen signaling pathway
oaa04917  Prolactin signaling pathway
oaa04926  Relaxin signaling pathway
oaa05034  Alcoholism
oaa05160  Hepatitis C
oaa05165  Human papillomavirus infection
oaa05200  Pathways in cancer
oaa05205  Proteoglycans in cancer
oaa05206  MicroRNAs in cancer
oaa05210  Colorectal cancer
oaa05211  Renal cell carcinoma
oaa05213  Endometrial cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05220  Chronic myeloid leukemia
oaa05221  Acute myeloid leukemia
oaa05223  Non-small cell lung cancer
oaa05224  Breast cancer
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
oaa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100084645 (SOS2)
   04010 MAPK signaling pathway
    100084645 (SOS2)
   04012 ErbB signaling pathway
    100084645 (SOS2)
   04630 Jak-STAT signaling pathway
    100084645 (SOS2)
   04068 FoxO signaling pathway
    100084645 (SOS2)
   04072 Phospholipase D signaling pathway
    100084645 (SOS2)
   04151 PI3K-Akt signaling pathway
    100084645 (SOS2)
   04150 mTOR signaling pathway
    100084645 (SOS2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100084645 (SOS2)
   04540 Gap junction
    100084645 (SOS2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100084645 (SOS2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100084645 (SOS2)
   04660 T cell receptor signaling pathway
    100084645 (SOS2)
   04662 B cell receptor signaling pathway
    100084645 (SOS2)
   04664 Fc epsilon RI signaling pathway
    100084645 (SOS2)
   04062 Chemokine signaling pathway
    100084645 (SOS2)
  Endocrine system
   04910 Insulin signaling pathway
    100084645 (SOS2)
   04912 GnRH signaling pathway
    100084645 (SOS2)
   04915 Estrogen signaling pathway
    100084645 (SOS2)
   04917 Prolactin signaling pathway
    100084645 (SOS2)
   04926 Relaxin signaling pathway
    100084645 (SOS2)
  Nervous system
   04722 Neurotrophin signaling pathway
    100084645 (SOS2)
  Environmental adaptation
   04714 Thermogenesis
    100084645 (SOS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100084645 (SOS2)
   05231 Choline metabolism in cancer
    100084645 (SOS2)
   05206 MicroRNAs in cancer
    100084645 (SOS2)
   05205 Proteoglycans in cancer
    100084645 (SOS2)
   05210 Colorectal cancer
    100084645 (SOS2)
   05225 Hepatocellular carcinoma
    100084645 (SOS2)
   05226 Gastric cancer
    100084645 (SOS2)
   05214 Glioma
    100084645 (SOS2)
   05221 Acute myeloid leukemia
    100084645 (SOS2)
   05220 Chronic myeloid leukemia
    100084645 (SOS2)
   05211 Renal cell carcinoma
    100084645 (SOS2)
   05215 Prostate cancer
    100084645 (SOS2)
   05213 Endometrial cancer
    100084645 (SOS2)
   05224 Breast cancer
    100084645 (SOS2)
   05223 Non-small cell lung cancer
    100084645 (SOS2)
  Substance dependence
   05034 Alcoholism
    100084645 (SOS2)
  Infectious diseases
   05160 Hepatitis C
    100084645 (SOS2)
   05165 Human papillomavirus infection
    100084645 (SOS2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100084645 (SOS2)
   01522 Endocrine resistance
    100084645 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 100084645
NCBI-ProteinID: XP_001515100
Ensembl: ENSOANG00000013979
Position
4
AA seq 1332 aa AA seqDB search
MQPPQQPYDFFGDENSRKWRGLFVPALRKVQQQVHPNLAAKEDSLYYIEELILQLLSKLC
IAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNLIIKVFREAFLSNRKLFSSYDI
EMIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQEI
LSADFHDHFHNLMSKPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCLHYFELLQQLQE
CSEEEEDRECLKQAITALLNLQCSMERIYRQHSPRRRPGDPVCRFYNRQIRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRLGAKHERHIFLFDGLMISCKTNHGQSRLPG
YSSAEFRLKEKFIMRKIQINDKDDTSECKHAFELVSKDENSIVFSAKSAEEKNNWMAALI
SLQYRSTLDRMLDSVLLKEENEQPLRLPSPELYRFVVKDSEDNIVFEENLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPDPEPTEADRLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLEKLESFITSVR
GKAMKKWVESIAKIIRRKKQAQANGISHNITFESPPPPIEWHLSRSGQLETFDLMTLHPI
EIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENLEERVAVLSRVIEILQVFQDLNNFNGVLEIVSAVNSVPVYRLDHTFEALQERKRRILD
EAVDLSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKQGKELINFSKRR
KVAEITGEIQQYQNQPYCLRIEAEIRGFFENLNPMGNTSEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKTTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPCKISFSRITEAEHETTV
SAPTSPNTPSTPPVSASSDLSVFLDIDLNSSYGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLVPPPLPPRKKFDQDASNSKGNLKSGDDPPAIPPRQPPPPKIKPRVPAYGGPFEGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFVNCPFNLQPPPMGHLHRDPDWFRETSTCPNSPN
TPPSTPSPRVPRRCCMLSSSHNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLH
RLSLLENAETPQ
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgccgcagcagccctacgacttcttcggcgacgagaacagccggaaatggcgg
gggctcttcgtcccggccctacggaaggttcagcagcaagttcacccaaatctcgcagca
aaagaagattccctctattatattgaagagttgattcttcagctgctcagtaaattatgc
atcgcccaaccaaggacagttcaagatgtggaggagcgagttcaaaagacatttccccat
ccaattgacaagtgggccattgctgatgcgcagtctgccattgagaaaaggaaacgaaga
aatcccctcttactacctgtggataaaattcatccatcattaaaggaagtcttaggctat
aaagtagattaccatgtttctctttacatcgtggccgtattggaatatatctcagctgat
attttgaaattagctggtaattatgttttcaatatccgacactatgaaatctcccagcag
gacataaaagtatcaatgtgtgcagataaggttttaatggatatgttcgatcaggacgac
attggtttggtttctctctgtgaagatgagccctcttcttcaggtgaattaaattactac
gacttagttagaactgaaattgccgaagaaaggcagtacctgcgagagctaaatctgatt
ataaaagtgtttcgcgaggctttcctatctaacagaaagctgttttcatcttacgatatt
gaaatgatattcagcaacatttcagatattcatgaattgaccgtgaagcttttaggtcta
attgaggacactgttgaaatgacagatgagagtagtcctcatcctttagctggcagctgt
tttgaagatctggcagaagagcaagcgtttgatccttatgaaaccttgtcacaggagatt
ctctcggcagactttcatgatcatttccataatttgatgtccaaacctgcagttgctctt
cattttcagtccattgctgatggttttaaagaggcagtgcgttatgtccttccacgtctc
atgctggtgccagtttaccattgcctgcactattttgaattattacagcaattacaagaa
tgcagtgaagaagaggaggacagagagtgtttgaaacaagccattactgcgctgttgaat
cttcaatgtagtatggaacggatttataggcagcattcacctagacgacgtcctggggat
ccagtttgtcggttttataaccgtcaaataagaagcaagcacctggccatcaaaaaaatg
aatgaaattcagaaaaatattgatggatgggaaggcaaagatattggccagtgttgtaat
gaatttatcatggaaggtccactaacaagattaggagctaagcatgaacgccatattttt
ctcttcgatggcttgatgatcagttgtaaaacaaatcatggacagtcccggcttccaggt
tacagcagtgcagagtttagactaaaagaaaaatttatcatgaggaaaattcaaatcaat
gataaagatgacactagtgaatgcaagcatgcttttgaattagtttccaaagatgaaaac
agcattgtgttttctgccaagtctgctgaggaaaaaaacaattggatggcagctttaatt
tctcttcagtatcggagtactctggatcgaatgcttgattctgtgttacttaaagaagaa
aatgagcagccactgagacttcccagcccagaattgtatcgttttgttgtgaaagactct
gaagataacattgtttttgaagaaaacttacaaagtaggagtggaattcctataattaaa
ggaggaactgtggtgaaattaattgaaagactaacatatcatatgtatgcagatcctaat
tttgtgcgaactttccttacaacgtatcggtccttttgcaaaccacaggaactgttgagc
ttattgatcgaaaggtttgaaatcccagatcctgagcctacagaagcggataggctggca
gtagagaaaggagagcagcccatcagtgcagaccttaaaaggtttcgcaaggaatatgtc
cagcccgttcaactgaggatactgaatgtgtttcgacactgggttgagcaccatttttac
gactttgagagagatttggaattgcttgaaaaattagaatcttttattacaagtgtaaga
ggaaaagccatgaagaagtgggtagaatcgattgctaaaatcatcaggcggaaaaaacaa
gctcaggcaaatggaatcagccataacattacattcgaaagtccacctccaccaattgaa
tggcatctcagcagatcgggacagttggaaacttttgacctcatgacactccatccgata
gaaattgctcgtcagctaacacttcttgaatctgacctctacagagccgttcagccttcc
gaacttgttggaagtgtgtggactaaagaagataaggagatcaattccccaaatttattg
aaaatgatcaggcatactaccaatcttactctttggtttgaaaagtgtatagtggaagca
gagaaccttgaagaacgagtggcagtgttgagtagagtcatagaaatcctgcaggttttt
caagatttaaacaatttcaatggtgtgttggagatcgtcagtgcagtgaattcagtgcct
gtgtacaggctagaccacacatttgaggcattacaagagaggaaaaggagaattttggat
gaagcagtggacctaagccaagatcactttaaaaaatacctggcaaagcttaaatcaatc
aatccaccctgcgtgcctttttttggaatctatttaacaaatattttgaagactgaagaa
ggaaataatgactttcttaaaaaacaaggaaaagaattaatcaacttcagtaagaggagg
aaagtcgctgaaattactggagaaattcagcagtatcagaatcagccttactgtttgcgg
attgaagcagaaataaggggattctttgaaaatctcaatcctatgggcaatacatctgaa
aaagaatttacagactacttgttcaataaatcacttgaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaaacaactttctctttaaagtctcctggaataaggccc
aatgctggcaggcatggctctacctcaggcactttacgaggtcacccgactcctctagaa
agagaaccgtgtaagataagcttcagtcggattactgaagctgagcacgagacaacagtg
tcagcaccgacgtctccaaacacaccatctactccaccggtctctgcttcctcagacctt
agtgtatttttagatatagatctcaacagttcctatggaagcaacagcatctttgctcca
gttctcttgccccattcaaaatcttttttcagttcatgtggaagtttacataaattaagt
gaagagccactggttcctcctcctcttccacctcgcaaaaagtttgatcaggacgcttca
aattccaagggaaatctgaaatctggtgacgaccctcctgctattccaccaagacagccg
ccacctccaaagataaagccacgtgttcctgcatacggtggtccttttgaaggacctctt
catagtccaccaccaccacctccaagggacccccttccagatactcctccaccagttcca
cttcgcccaccggaacacttcgtcaactgtccgttcaatcttcagccaccaccgatggga
catctccacagagatccagactggttcagagaaaccagtacatgtccaaattccccaaat
actcctccaagcaccccctctccaagggtaccacgccgctgctgtatgctcagttccagt
cacaacaatctcgctcatcctcaagctcccccggttccaccaaggcagaattctagccct
catttacccaaactgcctccaaagacttacaagagggagctttctcatcctcctttgcac
agactgtctttgctagaaaatgcagaaactcctcaatga

DBGET integrated database retrieval system