KEGG   Ornithorhynchus anatinus (platypus): 100084647Help
Entry
100084647         CDS       T01045                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100084647
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100084647
  Amino acid metabolism
   00310 Lysine degradation
    100084647
Enzymes [BR:oaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100084647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 153 aa AA seqDB search
MNRMRQRIAQRLKEAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVK
ASAFALQEQPVVNAVIDDATKEMVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERT
IGELGEKARKNELAIEDMDDPHVTEREPKAERG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggatgcggcagcgcattgctcagcgcctgaaggaagcccagaacacctgcgcg
atgctgaccaccttcaacgaggtggacatgagtaacatccaagaaatgagagcccggcac
aaggacgccttcctgaagaaacacaacctgaaactgggcttcatgtccgcttttgtgaag
gcctccgccttcgccctgcaggagcagccggtggtgaacgcagtgatcgacgatgcaacc
aaagagatggtgtacagggactatatcgacatcagcgtggccgtggccacgccccggggt
ctcgtggtgcccgtcatcaggaacgtggaaaccatgaactacgccgacatcgaacggacc
atcggcgaactgggggagaaggcccgaaagaacgaactggccatcgaggacatggacgat
cctcatgttacagagagggagcctaaggcagagagaggttga

DBGET integrated database retrieval system