KEGG   Ornithorhynchus anatinus (platypus): 100084647Help
Entry
100084647         CDS       T01045                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100084647
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100084647
  Amino acid metabolism
   00310 Lysine degradation
    100084647
Enzymes [BR:oaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100084647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 153 aa AA seqDB search
MNRMRQRIAQRLKEAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVK
ASAFALQEQPVVNAVIDDATKEMVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERT
IGELGEKARKNELAIEDMDDPHVTEREPKAERG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggatgcggcagcgcattgctcagcgcctgaaggaagcccagaacacctgcgcg
atgctgaccaccttcaacgaggtggacatgagtaacatccaagaaatgagagcccggcac
aaggacgccttcctgaagaaacacaacctgaaactgggcttcatgtccgcttttgtgaag
gcctccgccttcgccctgcaggagcagccggtggtgaacgcagtgatcgacgatgcaacc
aaagagatggtgtacagggactatatcgacatcagcgtggccgtggccacgccccggggt
ctcgtggtgcccgtcatcaggaacgtggaaaccatgaactacgccgacatcgaacggacc
atcggcgaactgggggagaaggcccgaaagaacgaactggccatcgaggacatggacgat
cctcatgttacagagagggagcctaaggcagagagaggttga

DBGET integrated database retrieval system