KEGG   Ornithorhynchus anatinus (platypus): 100084964Help
Entry
100084964         CDS       T01045                                 

Gene name
HIBCH
Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100084964 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100084964 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100084964 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100084964 (HIBCH)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100084964 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 90 aa AA seqDB search
TAIGLFPDVGGGYFLPRLPGKLGYFLALTGFRLRGRDVLKGGIATHFVHSEKLASLEKDL
VALKSPSKEQIASILDDYHAQVTNQLLLSL
NT seq 269 nt NT seq  +upstreamnt  +downstreamnt
actgcgatagggctgttcccagatgtgggtggaggctacttcctgccccggctgccggga
aagcttggctatttccttgccctcacgggcttccggctgagagggagagatgtgctcaag
ggaggaatcgccacacacttcgtccattccgagaagttggcttcactggagaaggatttg
gtagcattgaaatctccatccaaagagcagatcgccagcatcctggatgattaccacgcc
caggtaaccaaccagcttctgctttccct

  All links  
No link information was found.   
DBGET integrated database retrieval system