KEGG   Ornithorhynchus anatinus (platypus): 100084964Help
Entry
100084964         CDS       T01045                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:oaa01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:oaa00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:oaa00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:oaa00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 115 aa AA seqDB search
MKKPPIDTRTLILQLVWKARYELAREPSGFFLIPLAAGLFPDVGGGYFLPRLPGKLGYFL
ALTGFRLRGRDVLKGGIATHFVHSEKLASLEKDLVALKSPSKEQIASILDDYHAQ
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccccctatagatactagaacactgatcctgcagcttgtgtggaaagcaaga
tatgagttggcccgggagcccagtgggttttttctgattcccttggctgcagggctgttc
ccagatgtgggtggaggctacttcctgccccggctgccgggaaagcttggctatttcctt
gccctcacgggcttccggctgagagggagagatgtgctcaagggaggaatcgccacacac
ttcgtccattccgagaagttggcttcactggagaaggatttggtagcattgaaatctcca
tccaaagagcagatcgccagcatcctggatgattaccacgcccag

DBGET integrated database retrieval system