KEGG   Ornithorhynchus anatinus (platypus): 100085480Help
Entry
100085480         CDS       T01045                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa01522  Endocrine resistance
oaa01524  Platinum drug resistance
oaa04010  MAPK signaling pathway
oaa04012  ErbB signaling pathway
oaa04014  Ras signaling pathway
oaa04015  Rap1 signaling pathway
oaa04022  cGMP-PKG signaling pathway
oaa04024  cAMP signaling pathway
oaa04062  Chemokine signaling pathway
oaa04066  HIF-1 signaling pathway
oaa04068  FoxO signaling pathway
oaa04071  Sphingolipid signaling pathway
oaa04072  Phospholipase D signaling pathway
oaa04114  Oocyte meiosis
oaa04140  Autophagy - animal
oaa04150  mTOR signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04210  Apoptosis
oaa04218  Cellular senescence
oaa04261  Adrenergic signaling in cardiomyocytes
oaa04270  Vascular smooth muscle contraction
oaa04350  TGF-beta signaling pathway
oaa04360  Axon guidance
oaa04370  VEGF signaling pathway
oaa04371  Apelin signaling pathway
oaa04380  Osteoclast differentiation
oaa04510  Focal adhesion
oaa04520  Adherens junction
oaa04540  Gap junction
oaa04550  Signaling pathways regulating pluripotency of stem cells
oaa04611  Platelet activation
oaa04620  Toll-like receptor signaling pathway
oaa04621  NOD-like receptor signaling pathway
oaa04625  C-type lectin receptor signaling pathway
oaa04650  Natural killer cell mediated cytotoxicity
oaa04657  IL-17 signaling pathway
oaa04658  Th1 and Th2 cell differentiation
oaa04659  Th17 cell differentiation
oaa04660  T cell receptor signaling pathway
oaa04662  B cell receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04666  Fc gamma R-mediated phagocytosis
oaa04668  TNF signaling pathway
oaa04713  Circadian entrainment
oaa04720  Long-term potentiation
oaa04722  Neurotrophin signaling pathway
oaa04723  Retrograde endocannabinoid signaling
oaa04724  Glutamatergic synapse
oaa04725  Cholinergic synapse
oaa04726  Serotonergic synapse
oaa04730  Long-term depression
oaa04810  Regulation of actin cytoskeleton
oaa04910  Insulin signaling pathway
oaa04912  GnRH signaling pathway
oaa04914  Progesterone-mediated oocyte maturation
oaa04915  Estrogen signaling pathway
oaa04916  Melanogenesis
oaa04917  Prolactin signaling pathway
oaa04919  Thyroid hormone signaling pathway
oaa04921  Oxytocin signaling pathway
oaa04926  Relaxin signaling pathway
oaa04928  Parathyroid hormone synthesis, secretion and action
oaa04930  Type II diabetes mellitus
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa04934  Cushing's syndrome
oaa04960  Aldosterone-regulated sodium reabsorption
oaa05010  Alzheimer's disease
oaa05020  Prion diseases
oaa05034  Alcoholism
oaa05132  Salmonella infection
oaa05133  Pertussis
oaa05140  Leishmaniasis
oaa05142  Chagas disease (American trypanosomiasis)
oaa05145  Toxoplasmosis
oaa05152  Tuberculosis
oaa05160  Hepatitis C
oaa05161  Hepatitis B
oaa05164  Influenza A
oaa05165  Human papillomavirus infection
oaa05167  Kaposi's sarcoma-associated herpesvirus infection
oaa05200  Pathways in cancer
oaa05203  Viral carcinogenesis
oaa05205  Proteoglycans in cancer
oaa05210  Colorectal cancer
oaa05211  Renal cell carcinoma
oaa05212  Pancreatic cancer
oaa05213  Endometrial cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05216  Thyroid cancer
oaa05218  Melanoma
oaa05219  Bladder cancer
oaa05220  Chronic myeloid leukemia
oaa05221  Acute myeloid leukemia
oaa05223  Non-small cell lung cancer
oaa05224  Breast cancer
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
oaa05230  Central carbon metabolism in cancer
oaa05231  Choline metabolism in cancer
Module
oaa_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100085480
   04015 Rap1 signaling pathway
    100085480
   04010 MAPK signaling pathway
    100085480
   04012 ErbB signaling pathway
    100085480
   04350 TGF-beta signaling pathway
    100085480
   04370 VEGF signaling pathway
    100085480
   04371 Apelin signaling pathway
    100085480
   04668 TNF signaling pathway
    100085480
   04066 HIF-1 signaling pathway
    100085480
   04068 FoxO signaling pathway
    100085480
   04072 Phospholipase D signaling pathway
    100085480
   04071 Sphingolipid signaling pathway
    100085480
   04024 cAMP signaling pathway
    100085480
   04022 cGMP - PKG signaling pathway
    100085480
   04151 PI3K-Akt signaling pathway
    100085480
   04150 mTOR signaling pathway
    100085480
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100085480
  Cell growth and death
   04114 Oocyte meiosis
    100085480
   04210 Apoptosis
    100085480
   04218 Cellular senescence
    100085480
  Cellular community - eukaryotes
   04510 Focal adhesion
    100085480
   04520 Adherens junction
    100085480
   04540 Gap junction
    100085480
   04550 Signaling pathways regulating pluripotency of stem cells
    100085480
  Cell motility
   04810 Regulation of actin cytoskeleton
    100085480
 Organismal Systems
  Immune system
   04611 Platelet activation
    100085480
   04620 Toll-like receptor signaling pathway
    100085480
   04621 NOD-like receptor signaling pathway
    100085480
   04625 C-type lectin receptor signaling pathway
    100085480
   04650 Natural killer cell mediated cytotoxicity
    100085480
   04660 T cell receptor signaling pathway
    100085480
   04658 Th1 and Th2 cell differentiation
    100085480
   04659 Th17 cell differentiation
    100085480
   04657 IL-17 signaling pathway
    100085480
   04662 B cell receptor signaling pathway
    100085480
   04664 Fc epsilon RI signaling pathway
    100085480
   04666 Fc gamma R-mediated phagocytosis
    100085480
   04062 Chemokine signaling pathway
    100085480
  Endocrine system
   04910 Insulin signaling pathway
    100085480
   04912 GnRH signaling pathway
    100085480
   04915 Estrogen signaling pathway
    100085480
   04914 Progesterone-mediated oocyte maturation
    100085480
   04917 Prolactin signaling pathway
    100085480
   04921 Oxytocin signaling pathway
    100085480
   04926 Relaxin signaling pathway
    100085480
   04919 Thyroid hormone signaling pathway
    100085480
   04928 Parathyroid hormone synthesis, secretion and action
    100085480
   04916 Melanogenesis
    100085480
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100085480
   04270 Vascular smooth muscle contraction
    100085480
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100085480
  Nervous system
   04724 Glutamatergic synapse
    100085480
   04725 Cholinergic synapse
    100085480
   04726 Serotonergic synapse
    100085480
   04720 Long-term potentiation
    100085480
   04730 Long-term depression
    100085480
   04723 Retrograde endocannabinoid signaling
    100085480
   04722 Neurotrophin signaling pathway
    100085480
  Development
   04360 Axon guidance
    100085480
   04380 Osteoclast differentiation
    100085480
  Environmental adaptation
   04713 Circadian entrainment
    100085480
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100085480
   05230 Central carbon metabolism in cancer
    100085480
   05231 Choline metabolism in cancer
    100085480
   05205 Proteoglycans in cancer
    100085480
   05203 Viral carcinogenesis
    100085480
   05210 Colorectal cancer
    100085480
   05212 Pancreatic cancer
    100085480
   05225 Hepatocellular carcinoma
    100085480
   05226 Gastric cancer
    100085480
   05214 Glioma
    100085480
   05216 Thyroid cancer
    100085480
   05221 Acute myeloid leukemia
    100085480
   05220 Chronic myeloid leukemia
    100085480
   05218 Melanoma
    100085480
   05211 Renal cell carcinoma
    100085480
   05219 Bladder cancer
    100085480
   05215 Prostate cancer
    100085480
   05213 Endometrial cancer
    100085480
   05224 Breast cancer
    100085480
   05223 Non-small cell lung cancer
    100085480
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100085480
   05020 Prion diseases
    100085480
  Substance dependence
   05034 Alcoholism
    100085480
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100085480
   04933 AGE-RAGE signaling pathway in diabetic complications
    100085480
   04934 Cushing's syndrome
    100085480
  Infectious diseases
   05132 Salmonella infection
    100085480
   05133 Pertussis
    100085480
   05152 Tuberculosis
    100085480
   05164 Influenza A
    100085480
   05161 Hepatitis B
    100085480
   05160 Hepatitis C
    100085480
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100085480
   05165 Human papillomavirus infection
    100085480
   05145 Toxoplasmosis
    100085480
   05140 Leishmaniasis
    100085480
   05142 Chagas disease (American trypanosomiasis)
    100085480
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100085480
   01524 Platinum drug resistance
    100085480
   01522 Endocrine resistance
    100085480
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100085480
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100085480
Chromosome and associated proteins [BR:oaa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100085480
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100085480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Choline_kinase FTA2 Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 100085480
NCBI-ProteinID: XP_001515805
Position
Un
AA seq 119 aa AA seqDB search
AVLPPPSRGPSLTVGDSYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSAN
VLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSK
NT seq 358 nt NT seq  +upstreamnt  +downstreamnt
tgcggtcctgccccctccttcccggggcccgtccttgacggtcggggacagctacatcgt
gcaggacctgatggagacggacctctacaagctcctgaagacgcagcacctcagcaacga
ccacatctgctatttcctctaccagatcctgaggggcctcaagtacatccactccgccaa
cgtcctgcaccgggacctcaagccctccaacctgctgctcaacaccacgtgcgacctcaa
gatctgcgacttcgggctggcgcgggtcgccgacccggaccacgaccacacgggcttcct
gacggagtacgtggccacgcgctggtaccgggcccccgagatcatgctcaactcgaag

DBGET integrated database retrieval system