KEGG   Ornithorhynchus anatinus (platypus): 100085500Help
Entry
100085500         CDS       T01045                                 

Gene name
PNPLA6
Definition
(RefSeq) patatin like phospholipase domain containing 6
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100085500 (PNPLA6)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100085500 (PNPLA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1026 aa AA seqDB search
MRTGEALPDLLSCSLYGQRWAPVEAADMGQSESEQQPESKDTALADMLPSIKMFVEDQLQ
TSMVLGVMIGVGAAVLFIATLILVLVRRFRVKKVQAQETPKYRFRKRDKVLFYGRKIMRK
VSQSTSSLVDTTISTASRPRMKKKLKMLNIAKKILRIQKETPTLQRKEPPPAVLEADLTE
FDVANSHLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFQRLSQGDYVFRPGQPDASIYV
VQDGQLELCLTGPDGKEAVVKEVFPGDSVNSLLSILDVITGHQRPYRTVSARAALDSTVL
RLPVEAFSAVFAKYPESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEMQPLRLFPS
PGHPARTSPVRGPKRLTSTPSSEEPRDNPTRPPESPADPLKSGSGSGPGSGPGNLDPPSA
PLLSRCISMPVDISGLQRGPRSDFDMAYERGRISVSLQEESSETPLSGMPRSMSQEPREQ
PAGACQYSFCEDELAGGDCPFGPYQGRQTSSIFEAAKRELVKLMNIEDPTLLNSRVLLHH
AKAGTVIARQGDQDVSLHFVLWGCLHVYQRMIDKAEDVCLFVAQPGELVGQLAVLTGEPL
IFTLRAQRDCTFLRISKSDFYEIMREQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEA
GRALYRQGDRSDCTYIVLNGRLRSVIQRGTGKKELVGEYGRGDLIGVVEALTRQPRATTV
HAVRDTELAKLPEGTLSHIKRIYPQLEQMLESTAVRALKQLVLLHREEGPGPAHTVEWLN
MRSWCSGHLHLRCPRRLFSRRSPAKLRELYEKVFARRADRHSDFSRLARVLTGNTIALVL
GGGGASQQWANSMTSVFEPVLDLTYPITSMFSGSAFNRSIYRVFQDKQIEDLWLPYFNVT
TDITASAMRVHKDADIARTMGAKTVIAIDVGSQDETDLSNYGDSLSGWWLLWKRLNPWAE
KVKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQH
GKVVFG
NT seq 3079 nt NT seq  +upstreamnt  +downstreamnt
atgagaactggtgaggctctgccagacctgctgagctgctccctgtatggccagaggtgg
gcccccgtggaggccgcagatatggggcagagcgaatcagagcagcagccggagtcaaag
gacacggccctcgccgacatgctgcccagcatcaagatgtttgtggaagatcagctccag
accagcatggtcctgggagtaatgattggcgtgggagctgccgtgctgttcatcgcaacc
ctcatacttgtgctggtccggaggttccgtgtcaaaaaggtgcaggcccaggaaacgcca
aagtaccgattccgtaagagggataaagtgctcttctatggccgcaagatcatgcgcaag
gtctcccagtcgacctcctcactggtggacaccaccatctccactgcctcccgcccccgc
atgaagaagaaactcaagatgctcaacatcgccaagaagatcttgcggatccagaaggag
actccaacgctacagcggaaagagccgcccccggctgtgttggaggctgacctgactgag
tttgacgtggccaattcccacctcccctcagaggtgctctacatgctcaagaatgtccgg
gtgctgggacactttgagaaaccgctgttcctggagctgtgccgccacatggtgtttcag
cggctgtcccagggtgactacgtgttccggccaggccagcctgatgccagcatctatgtg
gtgcaggacgggcagctggaactctgcctcactggccccgacgggaaggaagcggtggtg
aaggaggtgttccctggggacagtgtcaatagcctgctcagcatcctggatgtcatcacg
gggcaccagcgcccgtatcgcacggtctcagcccgggcagccctggactcgacggttctg
cggttgccggtggaggccttctctgcggtttttgccaagtatcccgagagcctggtgcga
gtggtgcagatcatcatggtccgactgcagcgggtcaccttcctggctctgcacaactac
ctgggactcactaatgagctcttcagccacgagatgcaacccctgcgcctgtttcctagc
cccgggcacccagcccggaccagccccgtgcggggccccaagcgcctcaccagcaccccg
tcctcagaggaaccacgggacaaccccaccaggccccccgagtccccagcggatcccctg
aagtccggctctgggtctggccccggctccggccctggtaacctggatcccccgtctgcc
cctctgctgagccgctgcatctccatgcccgtggacatctctggtctgcagcggggacca
cgctctgattttgacatggcctatgagcggggacgcatttctgtgtcgctgcaggaagag
agctcggaaacccccctgtctgggatgccccggtcgatgtcccaggaacctcgagagcag
ccagcgggcgcctgccagtacagcttctgcgaggatgagttggctggcggggactgtcct
tttggaccctaccagggccgccagaccagcagcatcttcgaggccgccaaacgcgagcta
gtgaagctcatgaacattgaggaccccactctcctgaacagccgtgtgctgctgcaccac
gccaaagctggcaccgtcatcgcccgccaaggggaccaggacgtgagcctgcactttgtg
ctgtggggctgcctgcacgtctaccagcgcatgatcgacaaggcggaggatgtgtgcctg
tttgtggcacagcccggggagctggtggggcagcttgccgtgctgacgggggagcctctc
atcttcacgcttcgagcccagcgcgattgcaccttcctgcgcatctccaagtctgacttc
tatgagatcatgcgggagcagccaagtgtggttctgagtgcagctcacactgtggccgcc
cgcatgtcacccttcgtgcgccagatggacttcgctatcgactggaccgcagtggaggcc
gggcgtgccctctacaggcagggggaccgatcagactgcacctacatcgtgctgaatgga
cgcttgcgctcggtcatccagaggggaactggcaagaaggagctggtcggggaatatggc
cgtggggacctcatcggggtggtggaggccctgacccggcagccccgggcaaccactgtg
catgccgtgagggacacggagctggcaaagcttcccgaaggaaccctgagccacatcaag
agaatatacccacagctggagcagatgctggagagcacggctgtccgggccctgaagcag
ctggtactgctgcaccgggaggagggcccagggcccgcccacaccgtcgaatggcttaat
atgcgcagctggtgctctggccacctgcacctgcgctgcccccgccgcctcttctcccgc
cgcagccccgctaaactgagggagctctacgagaaggtatttgcccgccgagctgaccgc
cacagtgacttttcccgcctagcccgggtgctgaccgggaataccatcgccctggtgctg
ggcgggggtggagccagccaacagtgggccaatagcatgacatccgtgtttgagccggtc
ctggacctcacctaccccatcacctccatgttctcgggctcagccttcaaccgcagcatt
taccgcgtcttccaggacaagcagatcgaggacctgtggctgccgtacttcaatgtgacg
acagacatcacggcttccgccatgcgggttcacaaggacgcggacatagcgcggaccatg
ggggctaagacggtgatcgcgatcgacgtggggagccaagacgagaccgatctcagcaac
tatggggacagcctgtctggctggtggctgctctggaagcggctcaacccctgggctgag
aaggtcaaggtgcccgacatggctgaaatccagtcccgcctggcgtatgtgtcgtgcgtg
cggcaactggaggtggtgaaatcgagttcctactgtgaatacctgcggccacccattgat
tgcttcaagaccatggacttcggcaagttcgaccagatctatgacgtgggttaccagcat
gggaaggtggtgttcgggg

DBGET integrated database retrieval system