KEGG   Ornithorhynchus anatinus (platypus): 100085738Help
Entry
100085738         CDS       T01045                                 

Gene name
LAMC1
Definition
laminin, gamma 1 (formerly LAMB2)
Orthology
K05635  
laminin, gamma 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:oaa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:oaa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:oaa04510]
Human Diseases; Cancers; Pathways in cancer [PATH:oaa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:oaa05222]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:oaa05020]
Human Diseases; Infectious diseases; Amoebiasis [PATH:oaa05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:oaa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1723 aa AA seqDB search
MAAAWPQGGDGTPLPSRGGRRGSQASTLRSRRLPTELGERSPPPSISPPVRPGFGPCPFV
VVVVPGRPDLASIASAAPHRDPKSNSGAWLPVPPGKRESSMGGSRRGGPGLRGRPRAPLL
PPPPPLPLPLPLPLLLLLLLAGAVGRAPAAMDECTDEGGRPQRCMPEFVNAAFNVTVAAT
NTCGAPPEEYCVQTGVTGVTKSCHLCDAAQPHLQHGAAYLTDYNNQAETTWWQSQTMLAG
VQYPSTINLTLHLGKAFDITYVRLKFHTSRPESFTIYKRTREDGPWIPYQYYSGSCENTY
RKPNRAFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEFVTA
TDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKKDFDKLVCN
CKHNTYGVDCEKCLPFYNDRPWRRATAESANECLPCNCNGRSQECYFDPELYRSMGHGGH
CTNCQDNTDGANCERCRENFYRLGSEEACLPCHCSPVGSLSTQCDNYGLCSCKPGVMGDK
CDRCQPGYHSLTEAGCRPCACDPAGSTDECNIETGRCVCKDNVEGFNCERCKPGFFHLES
TNPRGCTPCFCFGHSSVCSNAQGYSIHTIISTFQIDQEGWRAEQRDGSEVSLQWSPENQD
ISVISDSYFPIYFIAPDQFLGNQVLSYGQNLTFSFRADKRDTRLSAEDLVLEGAGLRVSV
PLIAQGNSYPSETTLKYVFRLHEVTDYPWRPALTPFEFQKLLHNLTSIKIRGTYSERSAG
YLDDVTVMSARPGPGVPATWVESCTCPAGYGGQFCEHCIPGYRRETPSLGPYSPCVLCTC
NGHSESCNPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTNSDCQPCPCPEGSSCAVVPK
TKEVVCTNCPTGTTGKRCELCDDGYFGDPLGETGPVRLCRHCQCSDNIDPNAVGNCNRLT
GECLKCIYNTAGFYCDRCKDGFFGNPLAPDPADKCKACSCNPYGTVNQQTSCNQVTGQCE
CLPHVTERDCSACDPGFFNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCE
QCEVSHFGFGPEGCKPCDCDPEGSLSLQCKDNGRCECKEGFVGNRCDQCEENYFYNRSWP
GCQECPACYRLVKDKVAEHRLKLEELESLIANLGTGDETVTDQAFEDRLKEAERDVMDLL
REAQNIKDVDQSLMDRLQRVNNTLSSQLSRLQNIRNTVEETGDLAEQARSRVADTERLIE
IASRELEKAKVAVANVSITQPDSTSDPNNMTLLAEEARKLAERHKQEADDIVRVAKTAND
TSSEAYNMLLRTLAGENETANEIKELNRKYEQTKNISQDLEQQATRVHDEAKKAGDKAVE
IYASVAQLTPVDSVALENEANKIKKEAKDLDQLIDRKLKDYEDLREDMKGKELEVKNLLE
KGKTEQQTADQLLARADAAKALAEEAAKKGKNTLQEANDILNNLKDFDRRVNDNKTAAEE
ALKRIPAINQTIAEANEKTKEAHMALGNAAADATEAKNKAHEAEKIASVVQKNANSTKAE
ADRTFAEVTGLDKEVDEMMKQLQEAEKELQKKQDDANKDMEMAGMASQAAQAAEISARKA
KTSVGNLLTTINSLLEQLGQLDTVDLNKLNEIEGTLNQAKEEMTVSDLDRKVADLESEAK
KQEAAIVDYNRDIEEILKDIRNLEDIKKTLPSGCFNTPSIEKP
NT seq 5172 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcctggccccagggcggggacgggaccccactcccttcgagggggggccgt
cgaggaagtcaagcctccaccctccgaagccggcggctgccaactgaattaggcgagagg
tccccccctccctcgatttctccccctgtgcgccccggcttcggcccttgcccctttgtc
gtcgtcgtcgtccccgggcgtccggacttggcttcgatcgccagcgcagcgccccaccgg
gacccgaagagcaacagcggcgcctggctgcccgtgcccccggggaagcgggagagcagc
atgggggggagccggcggggcggcccggggctgcgggggaggccgcgggccccgctcctg
cctccgccgccgccgctgccgctgccgctgccgctgccgctgctgctgctgctgctgctg
gcgggcgccgtgggccgggcgccggccgccatggacgagtgcacggacgagggcgggagg
ccccagcgctgcatgcccgagttcgtcaacgccgccttcaacgtgaccgtggcggccacc
aacacgtgcggggccccgcccgaggagtactgcgtgcagaccggggtcaccggggtcacc
aagtcctgtcacctgtgcgacgccgcccagccccacctgcagcacggggccgcctacctg
accgactacaacaaccaagccgaaaccacctggtggcagagccagaccatgctggcgggg
gtgcagtaccccagcaccatcaacctcaccctgcatctggggaaggcctttgacattaca
tacgtgcgcctcaagttccacaccagccgtcctgagagcttcaccatatacaagcgcacc
cgggaagatgggccgtggatcccctaccagtattacagcggctcctgcgagaatacttac
aggaagccaaaccgggccttcattaggacgggcgaagatgagcagcaagcgttgtgtacg
gatgagttcagcgacatctctcctctcaccgggggcaatgtggccttctccacactggag
gggcgacccagcgcctacaattttgacaacagccctgtcctgcaggaattcgtaactgct
actgacatcagagttaccctgaatcgcctgaacacttttggagatgaagtttttaatgat
cccaaagttttgaagtcgtactattatgcaatctctgactttgctgttggcggcaggtgt
aagtgtaatggacatgcaagtgaatgtgtgaagaaggactttgataaactcgtgtgtaac
tgcaagcacaacacctatggggtagactgtgagaagtgtcttcccttctacaatgatcgg
ccatggaggagagcaacagcagaaagtgccaatgaatgtctgccctgcaactgcaatggg
cgatcacaggaatgctattttgaccccgagctctaccgatctatgggacacggtggacac
tgcacaaactgtcaggacaatactgatggtgctaattgcgagaggtgtcgggagaacttc
taccgcctggggagtgaagaagcgtgcttaccctgtcactgcagccctgttggttctctc
agcacccagtgtgacaactatgggctgtgtagctgtaagcccggggtgatgggagacaaa
tgtgatcgatgccagcccggctaccactccctcacggaggctggctgcagaccgtgcgct
tgcgatcctgccggcagcacagatgagtgtaacattgaaacgggacgatgcgtctgcaag
gataacgtggagggcttcaactgcgagagatgtaaacctggattctttcatctggaatca
accaatcccaggggttgcaccccctgtttctgttttgggcattcatctgtctgctctaat
gctcagggctacagtatccataccataatttctaccttccagatcgatcaggaagggtgg
cgtgcggagcagcgagatggttctgaagtttcactgcagtggtctcctgaaaaccaggac
atctctgttatttccgacagctacttccccatatatttcatagcacccgaccagttcttg
ggcaaccaagttttgagttatggtcagaatctcaccttctcttttcgggcggacaaacgg
gacacccgcctctcagcagaggacctggtgcttgaaggggccggcctgagagtgtctgta
cctctgattgctcagggcaacagttatccgagtgagaccacactcaaatatgttttccga
ctccatgaggtaaccgattatccctggaggcctgccctgaccccctttgaatttcaaaaa
ctgctccacaatctgacctctatcaagatccgtgggacatacagcgaaagaagtgctggc
tatctggatgatgtcactgtgatgagtgcccgtccagggcccggagtccccgcgacctgg
gtagagtcctgtacttgtcccgctggatacggagggcagttctgcgagcattgcatccct
gggtacagaagagagactcctagccttggcccttatagcccatgtgtcctgtgcacatgc
aatggccacagcgaatcctgcaatccggagacaggcgtttgtaactgcagagacaacaca
gcgggtcctcactgtgaaaagtgcagtgatgggtattatggagattccactgctggcacc
aactctgattgccaaccttgcccctgccccgaaggttcaagttgtgccgtcgtgcccaaa
actaaggaagtagtctgtaccaattgcccgactggcaccaccggtaaaagatgtgagctc
tgtgatgatggttattttggagatcctctgggtgaaaccggccctgtgaggctctgccga
cactgtcagtgcagcgacaacattgaccccaatgctgttgggaactgcaatcgcttaacc
ggagaatgcctgaaatgcatctacaacactgctggcttctactgtgaccgttgcaaagat
gggttctttggtaatccgctggcccctgacccagcagacaaatgcaaagcctgcagttgc
aatccttacggtactgtgaaccagcagacgagctgcaatcaggtcaccgggcagtgtgag
tgcctaccccatgtgacggagcgggattgcagtgcctgtgaccctggcttcttcaatctg
cagagtgggcagggatgtgagagatgtgactgccacgctctaggctctacaaatggccaa
tgcgatattcgcactgggcagtgtgaatgccagccaggcatcactggtcaacactgcgag
caatgtgaggtcagccactttggatttggacctgaaggctgtaaaccatgcgactgtgac
cctgaggggtctctttcactccagtgcaaagacaatggtcgctgtgagtgcaaagaaggc
ttcgtcggaaaccgttgtgaccaatgcgaagagaactatttctacaatcggtcttggcct
ggctgccaggagtgccctgcgtgctacagactagtgaaagataaggtagccgagcatcga
ctgaagctggaggaattagagagccttatcgccaaccttgggacaggggatgaaacggtg
acagatcaggcctttgaggacagactgaaagaggcagagagagatgtcatggacttgctg
cgtgaggcccagaacatcaaagatgtagaccagagcctgatggatcgtctccagagagtg
aacaacaccctgtccagccaacttagccgcttgcaaaatatccgcaatacagtcgaggag
acaggagacctggctgagcaagcccgttcccgggtagctgacacagagaggctgattgag
atcgcttccagagaactggaaaaggccaaagtggcagttgccaatgtgtccatcacccag
ccagattctaccagtgatccaaataacatgactcttttggcagaagaggctcgtaagctt
gctgaacggcacaaacaagaggctgatgacattgttcgcgtagccaagacagccaatgat
acgtcatctgaagcctataatatgctgttgaggactctggcaggcgagaatgaaacagcc
aatgagattaaggaactcaaccgaaagtatgaacaaaccaagaacatttcacaggacctg
gagcagcaggcaacccgtgtacatgatgaggcaaagaaagccggggacaaggctgtggag
atctatgccagtgtggcccagctcactcctgttgattcagtggcactcgagaatgaagca
aataagataaaaaaggaggctaaagatctggaccagctgatagacaggaagttgaaggat
tacgaagacctcagggaagacatgaaagggaaggaattggaagtaaagaatcttttggag
aaaggaaagaccgagcaacagacagctgaccagctcttggcccgagctgatgctgctaaa
gctctcgctgaggaagctgctaagaagggaaaaaacacattgcaagaagctaatgacatt
ctcaacaacctgaaagattttgacagacgggtaaatgataacaagacagcagcagaagag
gcactgaagaggatccctgcaattaaccagactattgctgaagccaacgaaaagacaaaa
gaagcacatatggcactgggcaatgctgctgcagatgccactgaggccaagaacaaggcc
cacgaggcggagaagattgccagtgtcgtccaaaagaatgccaacagcaccaaggcagaa
gcagacaggacttttgcagaagtcacaggtctggataaagaggtggatgagatgatgaag
cagctgcaggaggcagaaaaagaactgcagaaaaagcaagatgatgctaacaaggatatg
gagatggctgggatggcttcacaggctgcccaggctgcggagatcagtgcaagaaaagcc
aagacctctgttggcaacctgctcaccaccatcaatagccttctggaacaactagggcag
ctggacacagtggatttgaacaagctaaatgagatcgaggggaccctgaaccaagccaaa
gaggagatgacagtcagtgacttggaccggaaggtggccgacctagagagcgaagccaag
aagcaggaggctgccattgtggactacaacagggatatcgaggagatcctgaaagacatt
cgcaacctggaagacatcaagaagaccttgccatctggctgtttcaacactccctcgatt
gagaagccttaa

DBGET integrated database retrieval system