KEGG   Ornithorhynchus anatinus (platypus): 100085738Help
Entry
100085738         CDS       T01045                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma 1
  KO
K05635  
laminin, gamma 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100085738 (LAMC1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100085738 (LAMC1)
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    100085738 (LAMC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100085738 (LAMC1)
   05222 Small cell lung cancer
    100085738 (LAMC1)
  Neurodegenerative diseases
   05020 Prion diseases
    100085738 (LAMC1)
  Infectious diseases
   05146 Amoebiasis
    100085738 (LAMC1)
   05145 Toxoplasmosis
    100085738 (LAMC1)
Cell adhesion molecules and their ligands [BR:oaa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      100085738 (LAMC1)
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-10 Extracellular matrix (ECM) components
     100085738 (LAMC1)
    Laminin-11 Extracellular matrix (ECM) components
     100085738 (LAMC1)
   MCAM, CD146; melanoma cell adhesion molecule [KO:K06534]
    Laminin-8 Extracellular matrix (ECM) components
     100085738 (LAMC1)
   CXADR, CAR; coxsackievirus and adenovirus receptor [KO:K06788]
    Laminin-1 Extracellular matrix (ECM) components
     100085738 (LAMC1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      100085738 (LAMC1)
     Laminin-2 Extracellular matrix (ECM) components
      100085738 (LAMC1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      100085738 (LAMC1)
   VLA-3
      100085738 (LAMC1)
     Laminin-10 Extracellular matrix (ECM) components
      100085738 (LAMC1)
     Laminin-11 Extracellular matrix (ECM) components
      100085738 (LAMC1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      100085738 (LAMC1)
     Laminin-8 Extracellular matrix (ECM) components
      100085738 (LAMC1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      100085738 (LAMC1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      100085738 (LAMC1)
 7. Others
  DAG1; dystroglycan 1 [KO:K06265]
   Laminin-1 Extracellular matrix (ECM) components
    100085738 (LAMC1)
   Laminin-2 Extracellular matrix (ECM) components
    100085738 (LAMC1)
  APP; amyloid beta A4 protein [KO:K04520]
   Laminin-1 Extracellular matrix (ECM) components
    100085738 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1671 aa AA seqDB search
MEAPGPSGRRGSVDGSSMGRRQPSRSPGGELPRASGLGFDRQRSAPPGPEEQQRRLAARA
PGEAGEQHGGEPAGRPGAAGELLLLLLLAGAVGRAPAAMDECTDEGGRPQRCMPEFVNAA
FNVTVAATNTCGAPPEEYCVQTGVTGVTKSCHLCDAAQPHLQHGAAYLTDYNNQAETTWW
QSQTMLAGVQYPSTINLTLHLGKAFDITYVRLKFHTSRPESFTIYKRTREDGPWIPYQYY
SGSCENTYRKPNRAFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSP
VLQEFVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKK
DFDKLVCNCKHNTYGVDCEKCLPFYNDRPWRRATAESANECLPCNCNGRSQECYFDPELY
RSMGHGGHCTNCQDNTDGANCERCRENFYRLGSEEACLPCHCSPVGSLSTQCDNYGLCSC
KPGVMGDKCDRCQPGYHSLTEAGCRPCACDPAGSTDECNIETGRCVCKDNVEGFNCERCK
PGFFHLESTNPRGCTPCFCFGHSSVCSNAQGYSIHTIISTFQIDQEGWRAEQRDGSEVSL
QWSPENQDISVISDSYFPIYFIAPDQFLGNQVLSYGQNLTFSFRADKRDTRLSAEDLVLE
GAGLRVSVPLIAQGNSYPSETTLKYVFRLHEVTDYPWRPALTPFEFQKLLHNLTSIKIRG
TYSERSAGYLDDVTVMSARPGPGVPATWVESCTCPAGYGGQFCEHCIPGYRRETPSLGPY
SPCVLCTCNGHSESCNPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTNSDCQPCPCPEG
SSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGETGPVRLCRHCQCSDNIDPNA
VGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPDPADKCKACSCNPYGTVNQQTSC
NQVTGQCECLPHVTERDCSACDPGFFNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQP
GITGQHCEQCEVSHFGFGPEGCKPCDCDPEGSLSLQCKDNGRCECKEGFVGNRCDQCEEN
YFYNRSWPGCQECPACYRLVKDKVAEHRLKLEELESLIANLGTGDETVTDQAFEDRLKEA
ERDVMDLLREAQNIKDVDQSLMDRLQRVNNTLSSQLSRLQNIRNTVEETGDLAEQARSRV
ADTERLIEIASRELEKAKVAVANVSITQPDSTSDPNNMTLLAEEARKLAERHKQEADDIV
RVAKTANDTSSEAYNMLLRTLAGENETANEIKELNRKYEQTKNISQDLEQQATRVHDEAK
KAGDKAVEIYASVAQLTPVDSVALENEANKIKKEAKDLDQLIDRKLKDYEDLREDMKGKE
LEVKNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGKNTLQEANDILNNLKDFDRRVN
DNKTAAEEALKRIPAINQTIAEANEKTKEAHMALGNAAADATEAKNKAHEAEKIASVVQK
NANSTKAEADRTFAEVTGLDKEVDEMMKQLQEAEKELQKKQDDANKDMEMAGMASQAAQA
AEISARKAKTSVGNLLTTINSLLEQLGQLDTVDLNKLNEIEGTLNQAKEEMTVSDLDRKV
ADLESEAKKQEAAIVDYNRDIEEILKDIRNLEDIKKTLPSGCFNTPSIEKP
NT seq 5016 nt NT seq  +upstreamnt  +downstreamnt
atggaggccccggggccctccggccgccgcggttcggtcgacggctcctcaatggggcga
aggcagccaagccggagccctggaggcgaattaccccgggcgtccggacttggcttcgat
cgccagcgcagcgccccaccgggacccgaagagcaacagcggcgcctggctgcccgtgcc
cccggggaagcgggagagcagcatgggggggagccggcggggcggcccggggctgcgggg
gagctgctgctgctgctgctgctggcgggcgccgtgggccgggcgccggccgccatggac
gagtgcacggacgagggcgggaggccccagcgctgcatgcccgagttcgtcaacgccgcc
ttcaacgtgaccgtggcggccaccaacacgtgcggggccccgcccgaggagtactgcgtg
cagaccggggtcaccggggtcaccaagtcctgtcacctgtgcgacgccgcccagccccac
ctgcagcacggggccgcctacctgaccgactacaacaaccaagccgaaaccacctggtgg
cagagccagaccatgctggcgggggtgcagtaccccagcaccatcaacctcaccctgcat
ctggggaaggcctttgacattacatacgtgcgcctcaagttccacaccagccgtcctgag
agcttcaccatatacaagcgcacccgggaagatgggccgtggatcccctaccagtattac
agcggctcctgcgagaatacttacaggaagccaaaccgggccttcattaggacgggcgaa
gatgagcagcaagcgttgtgtacggatgagttcagcgacatctctcctctcaccgggggc
aatgtggccttctccacactggaggggcgacccagcgcctacaattttgacaacagccct
gtcctgcaggaattcgtaactgctactgacatcagagttaccctgaatcgcctgaacact
tttggagatgaagtttttaatgatcccaaagttttgaagtcgtactattatgcaatctct
gactttgctgttggcggcaggtgtaagtgtaatggacatgcaagtgaatgtgtgaagaag
gactttgataaactcgtgtgtaactgcaagcacaacacctatggggtagactgtgagaag
tgtcttcccttctacaatgatcggccatggaggagagcaacagcagaaagtgccaatgaa
tgtctgccctgcaactgcaatgggcgatcacaggaatgctattttgaccccgagctctac
cgatctatgggacacggtggacactgcacaaactgtcaggacaatactgatggtgctaat
tgcgagaggtgtcgggagaacttctaccgcctggggagtgaagaagcgtgcttaccctgt
cactgcagccctgttggttctctcagcacccagtgtgacaactatgggctgtgtagctgt
aagcccggggtgatgggagacaaatgtgatcgatgccagcccggctaccactccctcacg
gaggctggctgcagaccgtgcgcttgcgatcctgccggcagcacagatgagtgtaacatt
gaaacgggacgatgcgtctgcaaggataacgtggagggcttcaactgcgagagatgtaaa
cctggattctttcatctggaatcaaccaatcccaggggttgcaccccctgtttctgtttt
gggcattcatctgtctgctctaatgctcagggctacagtatccataccataatttctacc
ttccagatcgatcaggaagggtggcgtgcggagcagcgagatggttctgaagtttcactg
cagtggtctcctgaaaaccaggacatctctgttatttccgacagctacttccccatatat
ttcatagcacccgaccagttcttgggcaaccaagttttgagttatggtcagaatctcacc
ttctcttttcgggcggacaaacgggacacccgcctctcagcagaggacctggtgcttgaa
ggggccggcctgagagtgtctgtacctctgattgctcagggcaacagttatccgagtgag
accacactcaaatatgttttccgactccatgaggtaaccgattatccctggaggcctgcc
ctgaccccctttgaatttcaaaaactgctccacaatctgacctctatcaagatccgtggg
acatacagcgaaagaagtgctggctatctggatgatgtcactgtgatgagtgcccgtcca
gggcccggagtccccgcgacctgggtagagtcctgtacttgtcccgctggatacggaggg
cagttctgcgagcattgcatccctgggtacagaagagagactcctagccttggcccttat
agcccatgtgtcctgtgcacatgcaatggccacagcgaatcctgcaatccggagacaggc
gtttgtaactgcagagacaacacagcgggtcctcactgtgaaaagtgcagtgatgggtat
tatggagattccactgctggcaccaactctgattgccaaccttgcccctgccccgaaggt
tcaagttgtgccgtcgtgcccaaaactaaggaagtagtctgtaccaattgcccgactggc
accaccggtaaaagatgtgagctctgtgatgatggttattttggagatcctctgggtgaa
accggccctgtgaggctctgccgacactgtcagtgcagcgacaacattgaccccaatgct
gttgggaactgcaatcgcttaaccggagaatgcctgaaatgcatctacaacactgctggc
ttctactgtgaccgttgcaaagatgggttctttggtaatccgctggcccctgacccagca
gacaaatgcaaagcctgcagttgcaatccttacggtactgtgaaccagcagacgagctgc
aatcaggtcaccgggcagtgtgagtgcctaccccatgtgacggagcgggattgcagtgcc
tgtgaccctggcttcttcaatctgcagagtgggcagggatgtgagagatgtgactgccac
gctctaggctctacaaatggccaatgcgatattcgcactgggcagtgtgaatgccagcca
ggcatcactggtcaacactgcgagcaatgtgaggtcagccactttggatttggacctgaa
ggctgtaaaccatgcgactgtgaccctgaggggtctctttcactccagtgcaaagacaat
ggtcgctgtgagtgcaaagaaggcttcgtcggaaaccgttgtgaccaatgcgaagagaac
tatttctacaatcggtcttggcctggctgccaggagtgccctgcgtgctacagactagtg
aaagataaggtagccgagcatcgactgaagctggaggaattagagagccttatcgccaac
cttgggacaggggatgaaacggtgacagatcaggcctttgaggacagactgaaagaggca
gagagagatgtcatggacttgctgcgtgaggcccagaacatcaaagatgtagaccagagc
ctgatggatcgtctccagagagtgaacaacaccctgtccagccaacttagccgcttgcaa
aatatccgcaatacagtcgaggagacaggagacctggctgagcaagcccgttcccgggta
gctgacacagagaggctgattgagatcgcttccagagaactggaaaaggccaaagtggca
gttgccaatgtgtccatcacccagccagattctaccagtgatccaaataacatgactctt
ttggcagaagaggctcgtaagcttgctgaacggcacaaacaagaggctgatgacattgtt
cgcgtagccaagacagccaatgatacgtcatctgaagcctataatatgctgttgaggact
ctggcaggcgagaatgaaacagccaatgagattaaggaactcaaccgaaagtatgaacaa
accaagaacatttcacaggacctggagcagcaggcaacccgtgtacatgatgaggcaaag
aaagccggggacaaggctgtggagatctatgccagtgtggcccagctcactcctgttgat
tcagtggcactcgagaatgaagcaaataagataaaaaaggaggctaaagatctggaccag
ctgatagacaggaagttgaaggattacgaagacctcagggaagacatgaaagggaaggaa
ttggaagtaaagaatcttttggagaaaggaaagaccgagcaacagacagctgaccagctc
ttggcccgagctgatgctgctaaagctctcgctgaggaagctgctaagaagggaaaaaac
acattgcaagaagctaatgacattctcaacaacctgaaagattttgacagacgggtaaat
gataacaagacagcagcagaagaggcactgaagaggatccctgcaattaaccagactatt
gctgaagccaacgaaaagacaaaagaagcacatatggcactgggcaatgctgctgcagat
gccactgaggccaagaacaaggcccacgaggcggagaagattgccagtgtcgtccaaaag
aatgccaacagcaccaaggcagaagcagacaggacttttgcagaagtcacaggtctggat
aaagaggtggatgagatgatgaagcagctgcaggaggcagaaaaagaactgcagaaaaag
caagatgatgctaacaaggatatggagatggctgggatggcttcacaggctgcccaggct
gcggagatcagtgcaagaaaagccaagacctctgttggcaacctgctcaccaccatcaat
agccttctggaacaactagggcagctggacacagtggatttgaacaagctaaatgagatc
gaggggaccctgaaccaagccaaagaggagatgacagtcagtgacttggaccggaaggtg
gccgacctagagagcgaagccaagaagcaggaggctgccattgtggactacaacagggat
atcgaggagatcctgaaagacattcgcaacctggaagacatcaagaagaccttgccatct
ggctgtttcaacactccctcgattgagaagccttaa

DBGET integrated database retrieval system