KEGG   Ornithorhynchus anatinus (platypus): 100085895Help
Entry
100085895         CDS       T01045                                 

Gene name
MAP2K5
Definition
mitogen-activated protein kinase kinase 5
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:oaa04010]
Cellular Processes; Cell communication; Gap junction [PATH:oaa04540]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:oaa04921]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:oaa04722]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 399 aa AA seqDB search
MSSVAHWTSKCRYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRAC
KPPGKRNIHGLKVNTRAGPSHHSSPTISESLPGNSLKKSSAELKKILANGQMNEQDIENR
EPLGHGNGGTVYKAFHVPSGKILAVKVIPLDITVELQKQIMSELEILYKCDSSFIIGFYG
AFFVENRISICTEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNM
LVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMEL
ALGRFPYPQIQKNQGSLMPLQLLQCIVDEVSPVLPVGEFSEPFVHFITQCMRKQPKERPA
PEDLMGHPFVLQYNDGNAEVVSMWVCRMLEERRAQQGPQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagtggcccactggacatccaagtgtcgctatgaagacgaggatggcgatcga
attaccgtaagaagcgatgaagaaatgaaggccatgctgtcctattattattccacagta
atggaacagcaagtaaatggacagttaatagagcctttgcagatatttccaagagcctgc
aagcctcctgggaaacggaacatacatggcctgaaggtgaacacacgggctgggccctct
catcatagcagcccaacaatctcagagtcgcttccgggcaatagcttaaagaagtcatcc
gccgaactgaagaaaatattagccaatggccagatgaatgaacaagacatagaaaatcga
gagcccctcggtcacggcaacggaggtacagtctacaaagcatttcatgtccccagtggg
aagatattagctgtaaaggtcataccactagatattacagtggaacttcagaagcaaatt
atgtccgaattagaaattctctataagtgtgattcatcatttatcataggattttacggt
gcattttttgtagaaaacaggatctcgatatgtacagaattcatggatggaggatcgctg
gatgtgtacagaaaaattccagaacatgtactgggacggatagctgtcgcagtagttaaa
ggcctgacctatttatggagcttaaagattttgcacagagacgtcaagccctcaaacatg
ttggtgaacacaagaggacaggtcaagttgtgtgatttcggagttagcactcagctggtg
aattccatagccaagacgtacgtcgggacgaacgcttatatggcgcctgaaagaatttca
ggggaacagtatggaatccattccgatgtttggagcttaggaatctctttcatggagctt
gctcttgggaggtttccatatcctcagattcagaaaaaccagggatctttaatgcctctc
cagttattgcagtgcattgttgatgaggtttcgccggtccttccggttggagagttctcc
gagccatttgtacacttcatcactcagtgcatgaggaagcagccaaaagaaagaccagcc
cctgaggatttgatgggccatccatttgtcctgcagtacaacgacgggaacgccgaagtg
gtctccatgtgggtgtgcaggatgctggaagagcggcgggcccagcaggggcctcagtga

DBGET integrated database retrieval system