KEGG   Ornithorhynchus anatinus (platypus): 100086064Help
Entry
100086064         CDS       T01045                                 

Definition
muscarinic acetylcholine receptor M1-like
Orthology
K04129  
muscarinic acetylcholine receptor M1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:oaa04020]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:oaa04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:oaa04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:oaa04810]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:oaa04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 160 aa AA seqDB search
LLVLVSFKVNAELKTVNNYFLLSLACADLIIGAVSMNLYTTYVIMGRWALGTLACDLWLA
LDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILF
WQYLVGERTVKPGDCYIQFLSEPVITFGTAMAAFYLPVTV
NT seq 482 nt NT seq  +upstreamnt  +downstreamnt
ctcctggtgctggtgtccttcaaggtgaacgcggagctgaagacggtcaacaactacttc
ctgctgagcctggcctgcgccgacctgatcatcggcgccgtgtccatgaacctgtacacc
acttacgtgatcatgggccgttgggccctgggcacgctggcctgcgacctctggctggcc
ctggactacgtggccagcaacgcctccgtcatgaacctgctgctcatcagcttcgaccgc
tacttctccgtgacccggcccctgagctaccgggccaagcggacgccgcgccgggcggcc
ctgatgatcggcctggcctggctggtgtccttcgtcctctgggccccggccatcctcttc
tggcagtacctggtcggggagcggacggtgaagccgggggactgctacatccagttcctg
tcggagcccgtcatcaccttcggcaccgccatggcagccttctacctgcccgtcaccgtc
at

DBGET integrated database retrieval system