KEGG   Ornithorhynchus anatinus (platypus): 100086064Help
Entry
100086064         CDS       T01045                                 

Gene name
CHRM5
Definition
(RefSeq) cholinergic receptor muscarinic 5
  KO
K04129  
muscarinic acetylcholine receptor M1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100086064 (CHRM5)
   04024 cAMP signaling pathway
    100086064 (CHRM5)
   04151 PI3K-Akt signaling pathway
    100086064 (CHRM5)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100086064 (CHRM5)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100086064 (CHRM5)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100086064 (CHRM5)
G protein-coupled receptors [BR:oaa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    100086064 (CHRM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 164 aa AA seqDB search
LLVLVSFKVNAELKTVNNYFLLSLACADLIIGAVSMNLYTTYVIMGRWALGTLACDLWLA
LDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILF
WQYLVGERTVKPGDCYIQFLSEPVITFGTAMAAFYLPVTVMYAL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
ctcctggtgctggtgtccttcaaggtgaacgcggagctgaagacggtcaacaactacttc
ctgctgagcctggcctgcgccgacctgatcatcggcgccgtgtccatgaacctgtacacc
acttacgtgatcatgggccgttgggccctgggcacgctggcctgcgacctctggctggcc
ctggactacgtggccagcaacgcctccgtcatgaacctgctgctcatcagcttcgaccgc
tacttctccgtgacccggcccctgagctaccgggccaagcggacgccgcgccgggcggcc
ctgatgatcggcctggcctggctggtgtccttcgtcctctgggccccggccatcctcttc
tggcagtacctggtcggggagcggacggtgaagccgggggactgctacatccagttcctg
tcggagcccgtcatcaccttcggcaccgccatggcagccttctacctgcccgtcaccgtc
atgtatgccctc

DBGET integrated database retrieval system