KEGG   Ornithorhynchus anatinus (platypus): 100086194Help
Entry
100086194         CDS       T01045                                 

Definition
(RefSeq) steroid 21-hydroxylase-like
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100086194
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    100086194
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     100086194
Cytochrome P450 [BR:oaa00199]
 Cytochrome P450, animal type
  CYP21 family
   100086194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 323 aa AA seqDB search
MLPLALLLLGALAALWVWGVPLLRQSKLHLPPRVPGFLHQFRPNLPNHLLRLAQAHGPLY
RIHFGNQDVVILNSKELIQEAMIKNWLNFAGRPLTFSSKLVSLGGKDLSLGNYSPAWKDL
KKLTRSALLFGMRNKMEPLVWQLTHQLCEDFRAQPGSAVDLFQEFSRLTNRIVCTLTFGE
MERVHLAGPVRTASRNWCLCGPSPSITILLRLPFPPGDGETQAAGVVRDLMDYMLRELRE
KSGVWDVTEENLHMVLLDLVIGGTETTAATLTWVVLYLLHHPEREGRGDVVHAGNPSLAD
YLKPQVPPPRADPLAGPPASCRG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgttagcgctgcttctgctgggggccctggccgccctctgggtgtggggggtc
ccgctcctccgccagtcgaagctccacctgcccccacgtgtccccggtttcctgcaccag
ttccggcccaacctgcccaaccacctgctccgcctcgcccaggcacacgggcccctctac
cgcatccacttcgggaaccaggatgtggtgattctgaactccaaggaactgatccaggaa
gccatgatcaagaactggttgaacttcgcggggcgaccgctgaccttttcctccaagctg
gtgtccctgggcgggaaggacctgtctctggggaactactctccagcctggaaggacctg
aagaagctcactcgctccgctctcctgttcgggatgcgcaacaagatggagcccttggtg
tggcagctgacccaccagctgtgtgaggacttccgtgcccagcccggcagcgccgtggac
ttgttccaggagttctccaggctcaccaaccgcatcgtctgcaccctcacctttggggaa
atggagagagtccaccttgcaggacctgtacgaactgcatcacggaattggtgcctctgt
gggccttccccgtccatcaccatcctgttacgtcttccctttcctccgggtgacggggag
acgcaggcggccggcgtggtgcgggacctgatggactacatgctgcgggagctgcgggag
aagagcggcgtgtgggacgtcaccgaagagaacttgcacatggtgctcctcgacttggtc
atcgggggcacggagaccacggcggccacgctgacctgggtggtgctctacctgctccac
caccccgagagggagggccgtggggacgtggtacatgccggaaacccctcgctcgctgac
tacctgaaaccgcaagtcccgccgccccgggcggacccgctcgccggcccgccggcctcg
tgccgcggg

DBGET integrated database retrieval system