KEGG   Ornithorhynchus anatinus (platypus): 100086194Help
Entry
100086194         CDS       T01045                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100086194
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     100086194
Cytochrome P450 [BR:oaa00199]
 Cytochrome P450, animal type
  CYP21 family
   100086194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 320 aa AA seqDB search
MLPLALLLLGALAALWVWGVPLLRQSKLHLPPRVPGFLHQFRPNLPNHLLRLAQAHGPLY
RIHFGNQDVVILNSKELIQEAMIKNWLNFAGRPLTFSSKLVSLGGKDLSLGNYSPAWKDL
KKLTRSALLFGMRNKMEPLVWQLTHQLCEDFRAQPGSAVDLFQEFSRLTNRIVCTLTFGE
MERVHLAGPVRTASRNWCLCGPSPSITILLRLPFPPGDAGGRRGAGPDGLHAAGAAGEEG
VWDVTEENLHMVLLDLVIGGTETTAATLTWVVLYLLHHPEREGRGDVVHAGNPSLADYLK
PQVPPPRADPLAGPPASCRG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgttagcgctgcttctgctgggggccctggccgccctctgggtgtggggggtc
ccgctcctccgccagtcgaagctccacctgcccccacgtgtccccggtttcctgcaccag
ttccggcccaacctgcccaaccacctgctccgcctcgcccaggcacacgggcccctctac
cgcatccacttcgggaaccaggatgtggtgattctgaactccaaggaactgatccaggaa
gccatgatcaagaactggttgaacttcgcggggcgaccgctgaccttttcctccaagctg
gtgtccctgggcgggaaggacctgtctctggggaactactctccagcctggaaggacctg
aagaagctcactcgctccgctctcctgttcgggatgcgcaacaagatggagcccttggtg
tggcagctgacccaccagctgtgtgaggacttccgtgcccagcccggcagcgccgtggac
ttgttccaggagttctccaggctcaccaaccgcatcgtctgcaccctcacctttggggaa
atggagagagtccaccttgcaggacctgtacgaactgcatcacggaattggtgcctctgt
gggccttccccgtccatcaccatcctgttacgtcttccctttcctccgggagacgcaggc
ggccggcgtggtgcgggacctgatggactacatgctgcgggagctgcgggagaagagggc
gtgtgggacgtcaccgaagagaacttgcacatggtgctcctcgacttggtcatcgggggc
acggagaccacggcggccacgctgacctgggtggtgctctacctgctccaccaccccgag
agggagggccgtggggacgtggtacatgccggaaacccctcgctcgctgactacctgaaa
ccgcaagtcccgccgccccgggcggacccgctcgccggcccgccggcctcgtgccgcggg

DBGET integrated database retrieval system