KEGG   Ornithorhynchus anatinus (platypus): 100086436Help
Entry
100086436         CDS       T01045                                 

Definition
nuclear receptor coactivator 1-like
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Thyroid hormone signaling pathway
Class
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:oaa04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1010 aa AA seqDB search
GVSQALDGFFFVVNREGRIVFVSENVTGYLGYKQEELMNTSVYSVLHVGDHAELIKNLLP
KSLVNNVPWPQEAPRRSGHTFNCRMLLRDFHSCLICIARRFPRPPAVPGSESFMTKQDTT
GKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPHGREPSYARQLFQEVMTRGAAFSPPYR
FSLSDGTVLSARTKCKLCYPQSPDAQPFIMGIHIVDRDPSALSPPESPSSGLALPRVNPT
GHPALSPAPGLAPASALPPAASGQQPTPGPPPGPPPGSGSGTLSPRPPCPRWALPVGGAS
GACPGAHRPYAPGPGAALQGVCEGPGHPAGFAPTPPVLRPKTEPRDGKEVASLLSEMMQA
GDSPGEGQAPDAGTPPGGGGRGDHRRPEGDGKGPQGGGHRPGQLPANAAERRPLPADADP
GSGCRDASSCPGAPPGPSGSTGACPSSHSSLTERHKILHRLLQEGSPSDIGSPPPEPERR
DSGPPGLPANRAEQEGTRKKDQKDHQLLRYLLDKNEKTGAAPGPLSLDDVEVNLERAEPG
SPPSPDEARLGPQGRFTSDLEQLDQLLPALEKAVQLPGLCGSDRTEGSAPGVTLKQEIVP
TPLQPSSARLFTGLKRLPDPDLGSTDLQSGQPGAGDPLPWADNALSSVARGGPPAKPEDP
CLGSQLDELLCPPTTAEGRNDEKALLEQLVAFLSGQDETELAELDRALGIDKLVQPPLNA
QMLAQRQRELYSQQHRQRQLLQQRAMLMRQHSFAGSLPPTAPGMSAQMGAARLAQPSPHQ
FPYPPSYGTNPGTPPSSSSPFSPLPPGPEAALVSRGGVGGRAMMGGQFGAGMSPQTQQNV
FQYAGSGRPEGRAGERGKPGRGTAPVTETCPAPPRWSRCRACPALPITPGVTPAGLWSLW
PPPLLPCTLAKLWGGDDRGRDVIPSSAWGPAPSHRATGHGQAGARPKGFVDLAPTLALLA
FWMQQVQVFADVQCTVNVVGGEPYHLGQAAPLGAPSSQVPKSLLQQLLTE
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
ggggtctctcaggccctggacgggtttttcttcgtggtgaaccgagaggggaggatcgtg
tttgtgtccgagaacgtgaccggctacctgggctacaagcaggaggagctgatgaacacc
agcgtctacagcgtcctgcatgtgggtgaccatgccgagttaatcaaaaacctgctgccc
aaatctctagtgaacaatgtgccgtggccccaggaggccccccgccgcagcggccacacc
ttcaactgccggatgctgctgcgggatttccattcctgtttgatctgcatcgcccggcgc
ttcccgcggccgcccgccgtcccggggtccgagtccttcatgaccaagcaagacacgaca
ggtaaaatcatctccatcgacacgagctccctgcgggccgcgggccggacaggctgggag
gatctggtgcggaaatgcatctacgctttcttccagccgcatgggagggagccgtcctac
gcccggcagctgtttcaggaagtgatgacccgcggcgcggccttcagccccccgtaccgc
ttctccctgagcgacggcacagtgctcagcgcccgcaccaagtgcaaactgtgctacccg
cagagcccggacgcccagcccttcatcatgggcatccacatcgtcgacagggatcccagt
gcactttctcctccagaaagccccagctctggcctggcccttccccgggtgaatcccacc
gggcaccccgccctctcccctgcaccgggcctagcgccggcctccgcccttccccccgcc
gccagcggccagcagccgacccccggccccccgcccggccccccgcccggcagcggtagc
ggaaccctttctccccgccctccctgcccccgctgggctcttcccgtcggcggcgccagc
ggtgcctgtcccggcgcccaccggccctacgcgcccggcccgggcgccgccctgcagggc
gtctgcgaggggcccggccaccccgccggcttcgcccccacccctcccgtcctgcggccc
aagactgagcccagggacggcaaggaggtggcctccctcctgagcgagatgatgcaggcc
ggcgacagccccggagagggccaggctccggacgcgggcacgccgcccggcggcggaggc
agaggggatcaccggcgcccggagggggacggcaagggcccccagggcggcggccaccgc
cccgggcagctcccggccaacgcggccgagcggcggccgctccccgcggacgcggacccg
ggctccggctgccgggacgcctcttcctgcccgggggccccccccggcccctccggctcg
acgggcgcctgcccctcctcgcacagctcgctgaccgagcggcacaagatcctccaccgg
ctgctgcaggaggggagcccctcggacatcggctccccgccccccgagcccgagcgcagg
gacagcggccccccggggctcccggccaacagggcggagcaggaggggaccaggaagaag
gaccagaaggaccaccagctgctgcgctacctcctggacaagaacgagaagaccggggcc
gcccccggcccgctcagcctggacgacgtcgaggtcaacctggagcgggcggagcccggc
agcccgccctccccggacgaggcgcggctggggccccagggccggttcaccagtgacctg
gagcagttagaccagttactgccggcgctggagaaggcggtacagctgccgggcctgtgt
gggtcggaccggacggaaggcagcgcgcccggggtgaccctcaaacaagagatcgtgccg
acccctctccagccctcctccgccaggctgttcaccgggctaaagaggttgccggaccca
gatttggggagcaccgatctccagagcgggcagccaggggcaggtgacccgctcccgtgg
gcggacaacgcgctgagctccgtggcccgggggggaccacctgctaaaccggaggatccg
tgtctcggctcccagctggatgagctgctgtgtccccctacgacggcagagggtcgcaac
gacgagaaggccctcctggagcagctggtggccttcctgagcggccaggacgagaccgag
ctggccgagctggaccgcgcgctgggcatcgacaagctggtgcagcctcccctgaacgcg
cagatgctggcccagcgccagcgggagctgtacagccagcagcaccggcagcgccagctc
ttgcagcagcgagccatgctcatgcgccaacacagctttgcgggcagcctcccgcccacc
gcccccggaatgtcggcccagatgggggccgcccgcctggcgcagccctccccgcaccag
ttcccttaccccccgagttacggtacgaaccccggaaccccgcccagctcgtccagcccc
ttctcccccctccccccgggccccgaggctgccctggtcagccgtggcggtgtgggcggc
agagccatgatgggcggccagttcggagccgggatgagcccccagacgcagcagaatgtc
ttccagtatgcggggtcaggtaggcccgaggggcgggcgggcgagcggggaaagccgggc
cgtggcaccgctccggtgaccgagacgtgccccgcgccaccccggtggtcccgatgtcgc
gcctgccccgcgctgcccatcacgcctggtgtcaccccggcgggcctctggtcactctgg
ccaccgcccctcctcccgtgcaccctcgctaaactctggggcggcgacgacagaggcaga
gacgtcatcccttcctctgcctgggggccggccccctctcaccgggccactggccatggg
caagccggggcccggcccaaggggtttgtggatctggccccaactctcgctctccttgcc
ttttggatgcagcaggtccaggtgtttgcggacgtccagtgcacggtgaacgtggtgggg
ggggagccgtaccacctcggccaggccgcgcccctgggcgccccgtcgtcccaggtcccg
aagagcctcctgcagcagctgctgaccgagtag

DBGET integrated database retrieval system