KEGG   Ornithorhynchus anatinus (platypus): 100086557Help
Entry
100086557         CDS       T01045                                 

Definition
histone acetyltransferase KAT7-like
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100086557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 271 aa AA seqDB search
MAAPAFRRPPAASPEPKMAPAAAIRRPESRDAERDRKGRHGVHRSRRRRPRRKRRAAAAG
DAEEEDSSPVRTLQALGSEEPAYSTRRVTRSQQQPAPVTPKKYPLRQTRSSGSETEQVVD
FSDRDTKNAADHDESPPRTPTGNAPSSESDIDISSPNVSHDESVAKDLSLKDSGSDLSHR
PKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDK
QIEERMLSHRQDDNNRHATRHQVGGRADRPT
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcccgccttccggcgcccgccagcggcctcgcccgaacccaagatggcgccc
gcggccgccattcgccggcccgagtcacgtgacgcggagcgcgaccggaaaggccgccac
ggagtccaccggagccgccgccgccgcccgcgtcggaaacgccgggccgcagccgccggc
gatgccgaggaggaagattccagccccgtgcggaccctgcaggccttgggctcggaggag
ccggcctactccacccgccgcgtgacccgcagccagcagcagcccgccccggtcaccccc
aaaaagtacccgctccgccagacccgctcgtccggctcggagaccgagcaggtggtggac
ttctccgacagagacactaagaatgcggccgaccacgacgagtccccgccgcgcacgccc
accggcaacgccccctcgtccgagtcggacatcgacatctccagccccaacgtgtcgcac
gacgagagcgtcgccaaggacctctccctgaaggactcgggcagcgacctctctcaccgg
cccaaacgccgccgcttccacgagagctacaacttcaacatgaagtgcccgacgcccggc
tgcaattccctggggcacctcaccgggaagcacgagaggcacttctccatctccgggtgc
cccctctaccacaacctgtccgccgacgagtgtaaggtgagggcccagagccgggacaag
cagatcgaggaaaggatgctgtcccaccggcaagacgacaacaaccgacacgcgaccagg
caccaggtaggaggacgggcagaccggcccacg

DBGET integrated database retrieval system