KEGG   Ornithorhynchus anatinus (platypus): 100086570Help
Entry
100086570         CDS       T01045                                 

Gene name
USP19
Definition
(RefSeq) ubiquitin specific peptidase 19
  KO
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100086570 (USP19)
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100086570 (USP19)
Ubiquitin system [BR:oaa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100086570 (USP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1327 aa AA seqDB search
MSSGTGAAGQRRASQGLEDATNKKKQKDRANQESKEGERPAATGPKRGPAPGSELHSQEE
QVLEEDGRQWSGLFHEEIESSYSKVQYRKGGFLQLVLHKKIPLLCWPSLLKKKRPCGQDC
GTLCKENEQDLPSNPKKPSQVAGPEPQQGKRAQGRGDIGSGIGSGTPVGPSAKRAVHLGG
PGEGQVEPGARKGNLGPRRDATRATDPTTQAAAVAREAVPREPRGGKEKRVSSLGAPLAE
DKVTTAAIARGGGASPAVPRGRDAEKGDEPKEVAALETPTGDEPEPMVSLAFVKNDSYEK
GPDAVVVHVYVKEICKETCRVLFREQDFTLVFQTSDVNFLRLHPGCGPHTVFRWQVKLRN
LIEPDLCEYHFTVTRVNICLKKRQSQRWAGLEAPSTRGAVGGAKVAGPSGPTPLEKTPPG
GTSHPLSGKEEARGGEKEKPPTEDSPGLEGVATPMASEQSVAVKQEPNVASPKPTCMVPP
MPHSPVSSESVEEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDYFHDRS
FEMEINYSNPLGTGGRLAIGFAGLLRTLWKGTHHAFQPSKLKAIVAGKASQFTGYAQHDA
QEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMRNDSFVVDLFQGQ
YKSKLVCPVCTKVSITFDPFLYLPVPLPQKQKVLIVYYFAKEPHKKPVKFLVSISKENSS
AMEVLDSLAHSVHVKPENLRLAEVSKNRFHRIFLPSHSLDAISPSDPLLCFEVLSSDLAK
ERVIVLQVQQRPQVPSVPITKCAACQKKQQPEDEKLKRCTRCYRVGYCNQVCQKTHWPDH
KGLCRPENIGLPFLVSVPESRLTYARLSQLLEGFARYSVSVFQPPFQPGRVSPEQGSQTS
NPEKPDSLIKNACAASTQGLGDGDQDLHLPMEPQASAPAPEPHPEQGSGIAMRSRAPLDR
SSLLSPAASGFSEQATSSLSEGSLPRESTGEKGFKPEAVVPGYQQPTEGVGSHTPQFFIH
KIDAANKEQKLEDKGEVPLELSEDNSLALIWKNNERLKEFVLVGSKELEYMEDPGSASEA
ARAGHFTLEQCLNLFTKPEVLAPEEAWYCPKCKQHREASKQLMLWRLPNVLIIQLKRFSF
RSFIWRDKINDMVEFPVRNLDLSKFCIGQKDDHQLPTYDLYAVINHYGGMIGGHYTAYAR
LPSDKNSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNSPVERPPRGLLTDHRP
DLGSAAEATASQLEVGQVLVLGIPRLELWTGDPDEGCLRYFVLGTMVAIVAFFLNVFYPL
MYQSHWR
NT seq 3984 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcggtaccggtgccgcaggccaaaggagggcatcccaggggctggaggacgcc
accaacaagaagaagcagaaggatcgagctaaccaggagagcaaggagggggagcggcct
gctgccacaggccctaagagagggccagcccctggctcagagttgcactcccaggaggag
caagttctggaggaagatggccggcagtggagcggtctgtttcatgaggagatcgagagc
tcttacagcaaagtgcagtaccgcaagggtggcttcctgcagctggtgcttcacaagaag
atcccactgctgtgttggccctctctgctgaaaaagaagagaccctgtggccaggactgt
ggcaccctctgtaaggagaatgaacaggacctgccctccaacccaaagaagcccagccag
gtggccggccctgaaccccagcaggggaagcgggcccagggccgcggcgatatcgggtca
gggatcggctctgggaccccggtggggcccagcgccaagcgggccgtgcaccttggcgga
cccggcgaagggcaggtggagcctggggcccgcaagggcaacctgggcccccgaagggat
gcgacccgcgctaccgacccgacaactcaggcagcagcagtggcgcgggaggcagttccc
cgggaacctcgtggtgggaaagagaagcgagtttcctcactgggggctcccctggcggag
gacaaggtgacgacggcggcaatcgccaggggaggcggggcctccccagccgttccccgg
gggagagacgccgaaaagggagatgaaccgaaagaggtggcggccctggaaactccaact
ggtgatgagcctgaaccaatggtgagcctggcctttgtgaaaaatgactcctatgagaag
ggtcccgacgcggtggtggtgcacgtgtacgtgaaggagatctgcaaggagacctgccgc
gtgctgttccgtgagcaggacttcacccttgtcttccagaccagtgatgtgaactttttg
cggctgcatccgggctgtgggccccacacagtcttccgctggcaggtgaagctcaggaac
cttatcgagccagacctgtgcgagtatcactttactgtcacccgcgtcaacatctgcctt
aagaagcggcagagccagcgctgggcggggctagaggccccttccacacgaggtgcagtg
ggtggtgcaaaggttgctgggccatctggcccaactcctctggaaaaaactccacctggt
ggcacctcacaccccctctccggcaaggaggaggcccgaggtggggagaaggagaagccc
cccactgaggactccccgggactggagggggtggcgacccctatggcgtcagagcagtcc
gtcgctgtgaaacaagagccgaacgtcgcttcgcccaagcccacgtgcatggtacccccc
atgccgcacagcccagtgagtagtgagagcgtggaggaggaggaggaggaggaggagaag
aaggtgtgtctgcccggcttcaccggccttgtgaacctggggaacacctgcttcatgaac
agtgtcatccagtccctttctaacacccgcgagctccgggactacttccacgatcgctcg
tttgagatggagatcaactacagtaaccctctgggcacgggcgggcgcctggccatcggc
tttgcggggcttctgcggacactgtggaaaggcacccaccatgccttccagccctctaag
ctgaaggccatcgtggcaggcaaagccagccagttcacgggctatgcccagcatgatgcc
caggagttcatggcgttcctgttggatggcctccacgaggacttaaaccgcatccaaaac
aagccttacaccgagaccgttgattcggatgggcggccagatgaggtggtggctgaggag
gcctggcagcggcacaagatgaggaacgactcatttgttgtggacttgttccagggccag
tataagtcaaagctggtctgccctgtgtgcaccaaggtttccatcacttttgaccccttt
ctgtacctgccagtacccttgcctcagaaacagaaggtactcattgtctactactttgct
aaggagcctcacaagaagccagttaagttcttggtgagcatcagcaaagaaaattccagc
gctatggaggtccttgactcgctggcccacagcgtccatgtgaagcctgagaacctgcgc
ctggctgaggtgtctaagaaccgtttccaccgcatattcctgccctcccactcactggac
gccatctccccttcggacccactgctctgcttcgaggtcctgtcatcagacctggccaag
gagcgcgtcatagtgcttcaagtccagcagcgcccccaggtgcccagcgttcccatcacc
aaatgcgcggcttgccagaagaagcagcagccggaggatgaaaaactgaagcgttgtacc
cgctgctaccgggttggctattgcaaccaggtttgtcagaagacacactggccggatcac
aaaggcctctgccgccctgagaacatcggcttgccctttctcgtcagtgtgcccgagtcc
cgcctcacgtatgcccgcctctcccagctgctggaaggcttcgcaaggtattcggtgagt
gtgttccagccacccttccagccaggccgggtatctccagagcagggctcacaaacctcg
aatcccgagaaaccggactcgctgatcaagaacgcctgtgctgccagcacccaaggacta
ggggatggagaccaagacttgcacctccccatggaaccacaggcgtccgctccggctcct
gaaccgcaccccgaacagggaagtgggatcgccatgagaagccgggcacctcttgaccga
agttccctgctgagccccgccgcctcaggcttctctgagcaggcaaccagctcgctcagt
gagggcagcctcccgagggagtccactggagagaaaggattcaagcctgaagctgtagtt
ccagggtaccagcagcccactgagggtgtgggctcccacacccctcagttcttcatccac
aaaatcgatgccgccaataaagaacagaagctggaagataaaggtgaggtccctctggag
ctgagtgaggacaacagcttggccttgatctggaagaacaatgagcggctaaaggagttt
gtgctggtcggctccaaggagctggagtatatggaagaccctggctcagccagtgaggcg
gctcgggccggccacttcacgctggagcagtgcctcaacctcttcaccaagcctgaggtg
ctggcccccgaggaagcctggtactgccccaaatgtaagcagcatcgtgaagcctcaaag
cagctgatgctctggcgtctgcccaacgtgctcatcattcagctcaagcgcttctctttc
cggagcttcatttggagggataaaatcaatgacatggtggagttccccgtcaggaatctg
gacctgagcaaattctgcattggccagaaagacgaccaccagctgcccacttatgacctg
tatgctgttatcaaccattatgggggcatgattgggggacactacactgcctacgcccgc
ttgcccagtgacaagaacagccagcgcagtgatgtgggctggaggctttttgacgacagc
acggtcaccacggtggatgagagtcaagtggtgacccgatatgcctacgtcctcttttac
cgtcggcggaactctcctgtggagaggcccccacgggggcttctcaccgatcaccgccct
gacctggggtctgctgctgaggctaccgccagccagcttgaagttggtcaagtcctggtc
ctgggcattcccaggctggagctgtggacaggagatccagatgagggctgcctccgctac
ttcgtcctgggcaccatggtcgccattgtggcattcttcctgaatgttttctacccgctg
atgtaccagagccactggagataa

DBGET integrated database retrieval system