KEGG   Ornithorhynchus anatinus (platypus): 100086809Help
Entry
100086809         CDS       T01045                                 

Definition
cytochrome P450 2D14
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100086809
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100086809
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100086809
Cytochrome P450 [BR:oaa00199]
 Cytochrome P450, animal type
  CYP2 family
   100086809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 377 aa AA seqDB search
MAGQGEHREEEEGLGGPVHGPGAPAAPRPAPFLRQLREKFGDVFSLQFSWTNVVVLNGLA
AVKEALVQRSEETAGRPPLVTYDHLGFGPNSEGSPFSPRQILNAVPWLVTIPGLPQRIFR
AQKAFITLLDTFIEEHKKTRDPALPRDLTDAYLEQVDQAKDDPGSSFNDRNIRIVVTDLF
TAGTETTSTTLKWALLFMLLHPDVQSRVQVEIDQVIGRDRRPTMADQAKMPFTNAVIHEC
QRLGDIIPIGLPHLTLRDTQVQGFFIPEGTYLILNLSSVLKDDTVWEKPHQFYPEHFLDR
DGRFVKPEAFLPFSAGRRVCLGEPLARMELFLFFTALLQRFTLAEREDRPRPSLRGHFVT
KREHLVPQPYQLQALLR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcagggagagcaccgggaagaggaagagggcctcggcgggcccgttcacggt
cccggggcccccgccgctccccggcccgctccgttcctccggcagctgcgggagaagttc
ggcgacgtcttcagcctccagttctcctggaccaacgtggtggtgctcaacggcctcgcc
gcggtgaaggaggcgctggtgcagaggtccgaggagacggccgggaggccgcccctagtc
acctatgatcacctgggcttcgggcccaactcggaaggcagtccattctcaccccggcag
atcctcaatgccgtcccgtggctggtgaccatccccggcctgcctcagagaatcttccgg
gcccagaaggctttcataaccctcctggacaccttcatcgaggagcacaagaagactagg
gacccggccctgcccagggacctgacggacgcttacctggagcaggtggaccaggccaag
gacgatcccgggagcagcttcaacgaccggaacatccgcatagtcgtgacggatctcttc
accgccggcacagagaccacctccaccaccctaaagtgggccctactgtttatgctcctc
cacccagacgtccagagccgagtccaggtggagatcgaccaggtgatcggcagggacagg
aggccgaccatggcggaccaagccaagatgcctttcaccaatgcggtcatccacgagtgc
cagcgcttgggggacatcattcccatcgggctgccccacctgaccctccgggatacgcag
gtccagggcttcttcatccccgaggggacctatctgatcctcaacctgtcctccgtgctg
aaggacgacacggtctgggagaagccacaccagttctatccagagcattttctggaccgg
gacggccggttcgtgaagccagaggccttcctgcctttctctgcaggtcgccgcgtgtgc
ctgggggagccactggcccggatggagctcttcctcttcttcaccgcgctcctgcagcgc
ttcaccttggctgaaagggaagaccggcccaggccctcgctgcgaggccacttcgtcacc
aagagagaacaccttgtcccgcagccctaccaactccaagccctcctcagatag

DBGET integrated database retrieval system