KEGG   Ornithorhynchus anatinus (platypus): 100087048Help
Entry
100087048         CDS       T01045                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100087048 (ART1)
Cellular antigens [BR:oaa04090]
 Proteins
  100087048 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 298 aa AA seqDB search
DPVFPTQAANPFLPRVTTLDMAPASFDDQYIGCARDMEHELAALNQTEFAASRTYAEAWE
AASARWREHLSGGGGRPPWPPGFRDEHAVAVLAYTANGPLHREFNAAVREAGRSRAYYLR
YFPFKTLHFLLTQALALLGARQNPQCRRVYRGVAGVRFRTGAEPGGAVRFGHFASSSLHE
EAALQFGQDSFFSIRTCHGADIRAFSFFPGEEEVLIPPYERFRVVNASTGPHGLNHIHLQ
SLDKTSTYNCEYIKDKRCTSWRCRLNDSAAATGSKAFQWSHLPLFWSVWLVLSPLEPF
NT seq 898 nt NT seq  +upstreamnt  +downstreamnt
tgaccctgtcttcccgacccaggccgccaaccccttcctcccccgcgtgaccacgctgga
catggctccggcctcctttgacgaccagtacatcggctgcgctcgggacatggagcacga
gctggccgccctgaaccagactgagttcgccgccagccgcacctacgccgaggcctggga
ggcggcctcggcccgctggcgggagcacctgagcggaggaggagggaggcctccctggcc
cccgggcttccgggatgagcacgcggtggccgtcctggcctacaccgccaacgggcccct
gcaccgggagttcaacgccgccgtgcgagaggccggccgctcccgggcctactacctgcg
ctatttccccttcaagaccctccactttctgctgacccaggctctggctctgctgggggc
gcggcagaacccccagtgccgccgggtgtaccggggcgtggccggggtgcgattccggac
cggggccgagcccgggggggcagttcgtttcggccacttcgcctcctcctccctgcacga
agaggccgccctccagttcggccaggactccttcttctccatccggacctgccacggagc
cgacatccgcgccttctccttcttccccggagaggaggaggtgctcatccccccctacga
gaggttccgggtcgtcaacgccagcaccgggccccacggcctcaaccacatccacctgca
gtctctggacaagaccagcacctacaactgcgagtacatcaaagataagaggtgcacgtc
ctggaggtgcagattgaacgattcggcagcagccacggggagcaaggcctttcagtggtc
acacctacccctgttctggagcgtctggttggtactgagccccttggaacctttctga

DBGET integrated database retrieval system