KEGG   Ornithorhynchus anatinus (platypus): 100087092Help
Entry
100087092         CDS       T01045                                 

Gene name
USP48
Definition
ubiquitin specific peptidase 48
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 604 aa AA seqDB search
FLQELVERDNCKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLEWL
QKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRYGGGPRLNVKALC
KDCVVERCRVLRLKNQLNEDYKIVTNLLKVTVKSNEGFWVGKSSLRSWRQLALEQLDEQD
GEVDQSNGKMNGDALNKDESKEERKDEEEELNFNEDILCPHGDLCISENERRVVSKEAWR
KLKQYFPKAPEFPNYKECCSQCKILEREGEENEALHKMIANEQKASLQNLFQDKSRPCLS
SWPQETNVLYIVSQFFLEEWRKFVRRPTRCSPVSSIGNSALLCPHGGLMFTFASMTKEDS
KLIALIWPNEWDRMQKLFVVDHVIKIVKSEAEADDKSPSKTLYTSEPKLCPECREGLLCQ
QQRDLREYTQATIYVHKVVDNKKVMKEAAPELNVSSSETEEDREEAKPEGEKDPDFNQAN
GGAKRQKISHQNYLVYQKQVIRRSTRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPF
DQNLSIDGKVLNDDTATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCMPEEGFKGTG
LLGH
NT seq 1817 nt NT seq  +upstreamnt  +downstreamnt
ctttcctccaggagctggtggaacgtgataattgtaagtttgaagagtggtgtattgaaa
tggcggaaatgcgcaaacagagtgtggataaaggcaaagccaaacatgaagaggtgaagg
agctctaccaaaggttacctgccggagctgagccatatgaatttgtgtctcttgagtggc
tgcagaaatggctggatgaatctacaccaacaaagcccatcgacaaccatgcttgcctgt
gttcccacgacaaactacacccggacaaaatctccattatgaagagaatatcggaatatg
cagctgacattttctacagcagatacggaggggggccgaggcttaatgttaaagcacttt
gcaaggattgcgtggtagaacgatgtcgagtattgcgattgaagaaccaattaaatgaag
actataaaattgttacaaatttgctaaaagttacagtaaagagcaatgaaggattttggg
ttgggaaatcttccttacggagttggcggcaactagctctggaacagttagatgaacaag
atggtgaagtagaccaaagtaatgggaaaatgaatggtgatgccctaaataaagatgaat
caaaagaagaaagaaaagatgaggaggaagaattgaatttcaatgaagacattctgtgtc
ctcatggtgatttatgcatatcagaaaacgaaagaagagttgtttctaaagaagcttgga
gaaaactcaaacagtactttccaaaggcacctgaattccccaattataaagagtgctgtt
cacaatgcaagattctggaaagagagggggaagaaaatgaagctttacataagatgatag
caaatgaacagaaggcttctctccagaacctgttccaggacaaaagcagaccatgcctta
gtagctggccacaggagaccaatgtactctacattgtgtcccagttttttctagaagagt
ggaggaaatttgtcagacggcctaccagatgtagcccggtatcatcgataggaaacagtg
ctctcctctgtcctcatggaggacttatgtttacttttgcttccatgaccaaagaggatt
ctaaacttatagctctaatatggcccaatgaatgggataggatgcaaaaattatttgtcg
tggatcacgtgatcaaaatcgtcaaatcagaagcagaagcagatgataaaagcccctcga
aaacactgtatacttctgagcctaaactctgtccggaatgccgagaaggactgttgtgtc
agcagcagagggacctgcgtgagtacactcaagccaccatctatgtacacaaagttgtgg
ataataaaaaggtaatgaaggaagcagctccagaattgaatgtgagtagttcggaaactg
aagaagacagagaagaagccaaaccagagggggaaaaggacccagattttaaccaggcca
acgggggagcaaagcggcagaagatatcccatcagaattacttagtctatcaaaagcagg
tcattcgtcggagcacacggcacaggaaggtgcggggtgagaaagccctgcttgtttcag
ctaatcagacgctaaaagaactgaaaatccagatcatgcatgcgttttcggtggctcctt
ttgaccagaatctgtctatcgatgggaaggtcctgaatgatgacacggcgaccctcggca
ccctcggcgtcattccggaatcggtcattttgttaaaggctgacgaaccaatcgctgatt
atgccgcaatggacgatgttatgcaagtttgtatgcctgaagaaggatttaaagggactg
gcctacttggacattaa

DBGET integrated database retrieval system