KEGG   Ornithorhynchus anatinus (platypus): 100087210Help
Entry
100087210         CDS       T01045                                 

Definition
(RefSeq) perforin-1-like
  KO
K07818  perforin 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04210  Apoptosis
oaa04650  Natural killer cell mediated cytotoxicity
oaa04940  Type I diabetes mellitus
oaa05320  Autoimmune thyroid disease
oaa05330  Allograft rejection
oaa05332  Graft-versus-host disease
oaa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100087210
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100087210
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    100087210
   05330 Allograft rejection
    100087210
   05332 Graft-versus-host disease
    100087210
  Cardiovascular diseases
   05416 Viral myocarditis
    100087210
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100087210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF C2 Band_7_1 DUF2357
Motif
Other DBs
NCBI-GeneID: 100087210
NCBI-ProteinID: XP_001517199
Position
Un
AA seq 556 aa AA seqDB search
MGGCFLLLPFFLLLRPLPVPAPCHTATRAECKKHQKFIPGSQLVGEGVDITTLRHTGFFP
VDLNKYLRKDGTCTLCRNDHQGGDLQLLPLAVTDWRAEMTKCQRAVVKAMARSAAEVATS
AAKKIQNNWKADLNVTPKPAVNVQVSVAGSHSREANFAAGKLQQDKYVFTSDTVECRYYR
FRLIQMPPLEFDFKRAMHFLPDKFTPSTQTEYFQLIANFGTHFITSVELGGRTTDITALR
TCMLTLDGVTADEVADCLAVEAAVSVAGKGEATFESKRCEEKNKKHNLKGSFHETYNERH
VDVVGGQHESIADLIFGTTKETQQFSAWMATLPASPGLVTYSLDPLHFLLPKNDPRKEEL
RQAVSEYIIQKARWQNCTRPCPAGKVKSAHDPCRCVCHESWGMNEECCPKKRGLAKLQVK
IIKASGLWGDYFTSTDAYVRVFFGGFEQRTPTIWNNNNPVWQTDIDFGPVQLNSGGPLRI
QVWDADNGWDDDLLGTCDWAPHTEDSKIQDCYLNHGSVSFQYDVSCAPHLKGSTCLEYAH
QGLLGKPVGNRSGAVW
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgggaggctgcttccttctcctccccttcttccttctcctccggccattgcccgtccct
gccccctgccacactgccacccgggcagagtgtaagaagcaccagaagttcatcccgggg
tcccagctggtaggtgaaggtgtggacatcaccacccttcggcacacgggcttcttcccc
gtggatctgaataaatatcttcggaaggatgggacctgcactctctgccgcaatgaccat
caagggggggatctccagctcctccctttggccgtcacggactggcgtgccgaaatgacc
aagtgccaaagggcagtggtcaaagcaatggctcgttcagcggcagaggtggccacttcg
gcagccaagaagatccagaataactggaaggcagacctgaatgtgactcccaaaccagca
gtcaacgtccaggtgtcggtggccggatcccactccagagaagccaattttgccgcaggg
aagctgcagcaggacaagtatgtcttcaccagtgacacggtggagtgtcgctactacagg
ttccgccttattcaaatgccgcccctggagtttgatttcaagcgggctatgcacttcctg
cctgacaaattcactccctccactcaaaccgaatactttcaattaattgctaacttcggc
acccatttcattacgtccgtggagctggggggccggacaaccgacatcaccgccctgcgc
acctgcatgctgacgctggacggggtcacggccgacgaggtggccgactgcctggcagtg
gaagccgcggtgagtgtggctggcaagggggaagccacgtttgaaagcaagcggtgcgag
gagaagaataaaaagcataatctcaaagggtccttccacgagacgtacaacgagcggcat
gtggatgtggtgggaggccagcacgagagcatcgctgacctgatctttgggaccaccaaa
gagacgcaacagttctccgcctggatggccacacttccagcatcccctgggctggtgacc
tactccctggaccctctccactttctcctgcccaaaaatgatccccgcaaggaagaacta
aggcaggccgtgagtgagtatattatccagaaggcgcggtggcaaaactgcacccggcct
tgtcctgctgggaaggtaaaaagcgcccatgacccctgtcgctgtgtgtgccatgaatca
tggggcatgaatgaggaatgctgtcccaagaagcggggtcttgcaaagttacaagtgaaa
atcattaaggcaagcggtttgtggggagactatttcaccagcacagatgcctacgtcaga
gtgttttttgggggatttgagcagaggacacccacgatatggaataacaacaacccagtg
tggcagaccgatatagattttgggcctgtgcagttgaactcggggggacccctcaggata
caggtatgggacgctgacaacggctgggatgatgatctcctgggtacttgtgactgggct
ccccatacagaggattcgaagattcaggactgctatctgaaccacgggtcggtgtcattc
cagtatgacgtgtcctgtgcaccccacctaaaggggtcaacgtgcctggagtatgcccac
cagggcctcctgggaaagccagtagggaaccgaagtggggcggtgtggtga

DBGET integrated database retrieval system