KEGG   Ornithorhynchus anatinus (platypus): 100087210Help
Entry
100087210         CDS       T01045                                 

Definition
perforin-1-like
Orthology
K07818  
perforin 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100087210
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    100087210
   05330 Allograft rejection
    100087210
   05332 Graft-versus-host disease
    100087210
  Cardiovascular diseases
   05416 Viral myocarditis
    100087210
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100087210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 556 aa AA seqDB search
MGGCFLLLPFFLLLRPLPVPAPCHTATRAECKKHQKFIPGSQLVGEGVDITTLRHTGFFP
VDLNKYLRKDGTCTLCRNDHQGGDLQLLPLAVTDWRAEMTKCQRAVVKAMARSAAEVATS
AAKKIQNNWKADLNVTPKPAVNVQVSVAGSHSREANFAAGKLQQDKYVFTSDTVECRYYR
FRLIQMPPLEFDFKRAMHFLPDKFTPSTQTEYFQLIANFGTHFITSVELGGRTTDITALR
TCMLTLDGVTADEVADCLAVEAAVSVAGKGEATFESKRCEEKNKKHNLKGSFHETYNERH
VDVVGGQHESIADLIFGTTKETQQFSAWMATLPASPGLVTYSLDPLHFLLPKNDPRKEEL
RQAVSEYIIQKARWQNCTRPCPAGKVKSAHDPCRCVCHESWGMNEECCPKKRGLAKLQVK
IIKASGLWGDYFTSTDAYVRVFFGGFEQRTPTIWNNNNPVWQTDIDFGPVQLNSGGPLRI
QVWDADNGWDDDLLGTCDWAPHTEDSKIQDCYLNHGSVSFQYDVSCAPHLKGSTCLEYAH
QGLLGKPVGNRSGAVW
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgggaggctgcttccttctcctccccttcttccttctcctccggccattgcccgtccct
gccccctgccacactgccacccgggcagagtgtaagaagcaccagaagttcatcccgggg
tcccagctggtaggtgaaggtgtggacatcaccacccttcggcacacgggcttcttcccc
gtggatctgaataaatatcttcggaaggatgggacctgcactctctgccgcaatgaccat
caagggggggatctccagctcctccctttggccgtcacggactggcgtgccgaaatgacc
aagtgccaaagggcagtggtcaaagcaatggctcgttcagcggcagaggtggccacttcg
gcagccaagaagatccagaataactggaaggcagacctgaatgtgactcccaaaccagca
gtcaacgtccaggtgtcggtggccggatcccactccagagaagccaattttgccgcaggg
aagctgcagcaggacaagtatgtcttcaccagtgacacggtggagtgtcgctactacagg
ttccgccttattcaaatgccgcccctggagtttgatttcaagcgggctatgcacttcctg
cctgacaaattcactccctccactcaaaccgaatactttcaattaattgctaacttcggc
acccatttcattacgtccgtggagctggggggccggacaaccgacatcaccgccctgcgc
acctgcatgctgacgctggacggggtcacggccgacgaggtggccgactgcctggcagtg
gaagccgcggtgagtgtggctggcaagggggaagccacgtttgaaagcaagcggtgcgag
gagaagaataaaaagcataatctcaaagggtccttccacgagacgtacaacgagcggcat
gtggatgtggtgggaggccagcacgagagcatcgctgacctgatctttgggaccaccaaa
gagacgcaacagttctccgcctggatggccacacttccagcatcccctgggctggtgacc
tactccctggaccctctccactttctcctgcccaaaaatgatccccgcaaggaagaacta
aggcaggccgtgagtgagtatattatccagaaggcgcggtggcaaaactgcacccggcct
tgtcctgctgggaaggtaaaaagcgcccatgacccctgtcgctgtgtgtgccatgaatca
tggggcatgaatgaggaatgctgtcccaagaagcggggtcttgcaaagttacaagtgaaa
atcattaaggcaagcggtttgtggggagactatttcaccagcacagatgcctacgtcaga
gtgttttttgggggatttgagcagaggacacccacgatatggaataacaacaacccagtg
tggcagaccgatatagattttgggcctgtgcagttgaactcggggggacccctcaggata
caggtatgggacgctgacaacggctgggatgatgatctcctgggtacttgtgactgggct
ccccatacagaggattcgaagattcaggactgctatctgaaccacgggtcggtgtcattc
cagtatgacgtgtcctgtgcaccccacctaaaggggtcaacgtgcctggagtatgcccac
cagggcctcctgggaaagccagtagggaaccgaagtggggcggtgtggtga

DBGET integrated database retrieval system