KEGG   Ornithorhynchus anatinus (platypus): 100087245Help
Entry
100087245         CDS       T01045                                 

Gene name
P4HB
Definition
prolyl 4-hydroxylase, beta polypeptide
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100087245 (P4HB)
Enzymes [BR:oaa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100087245 (P4HB)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100087245 (P4HB)
  Exosomal proteins of colorectal cancer cells
   100087245 (P4HB)
  Exosomal proteins of bladder cancer cells
   100087245 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 512 aa AA seqDB search
MPTGGLLCLALALALAGGVRADAPEEEDHVLVLKKSNFEEALAAHKFLLVEFYAPWCGHC
KALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEY
TAGREADDIVNWLKKRTGPAAATLPDVAAAEALVESSDVAVVGFFKDAGSEPAKQFLAAA
ESIDDIPFGITSGGEVFAKYQLDEDGVVLFKKFDEGRNSFSGEVTKENLSNFIKQNQLPL
VIEFTEQTAPKIFGGEIKTHILLFLPKSVADYDGKLNNFKKAAGSFKGKILFIFIDSDHT
DNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTADKIKEFCDRFLEGKVKPHLM
SQDLPADWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGEAFKD
HENVVIAKMDSTANEVEAVKVHSFPTLKFFPASAEKTVIDYNGERTLEGFTKFLESGGQD
GAADDDDLEDLEEAEEPDLEEDDDQKNLRDEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgccgactggcggcctgctctgcctggccctggccctggccctggcgggcggcgtccgc
gccgacgcccccgaagaggaggaccacgtcctcgtcctgaagaagagcaacttcgaggag
gccctggcggcccacaagttcctcctggtggagttctacgccccctggtgcggtcactgc
aaagccctggcccccgagtacgccaaggccgccggcaagctgaaggccgaaggctccgag
atccgactggccaaggtggacgccacggaggagtcggacctggcccagcagtacggggtc
cgaggctaccccaccatcaagttcttcaagaacggggacacggcctcccccaaggagtac
acagccggcagggaggcggacgacatcgtgaactggctgaagaagcggacgggcccggcc
gccgccaccctgccggacgtcgcggccgccgaggccctggtggagtcgagcgacgtggcc
gtcgtcggcttcttcaaggatgcgggatcggagccggccaagcagttcctggcggcggcc
gagtccatcgacgacatccccttcggcatcacgtccggcggcgaggtcttcgccaagtac
cagctggacgaggacggcgtcgtcctcttcaagaagttcgacgaaggccgcaacagcttc
tccggggaggtcaccaaagagaacctgtccaacttcatcaagcagaaccagttgcccttg
gtcatcgagttcacggagcagacggccccgaagatcttcgggggcgagatcaagacgcac
atcctgctcttcctgcccaagagcgtggccgactacgacggcaagctgaacaacttcaag
aaggcggctggcagcttcaagggcaagatcctcttcatcttcatcgacagcgaccacacg
gacaaccagcggatcctggagttcttcggcctgaagaaagaggagtgcccggccgtccgc
ctcatcaccctggaggaggagatgaccaagtacaagcccgagtcggacgagctgacggcg
gacaagatcaaggagttctgcgaccgcttcctggagggcaaggtcaagccgcacctgatg
agccaggaccttcccgccgactgggataaacagcccgtcaaggtcctggtgggcaaaaac
ttcgaagaggtcgccttcgacgagaagaagaacgtcttcgtggagttctatgccccctgg
tgcgggcactgcaagcagctggcgcccatctgggacaaactgggcgaggccttcaaggac
cacgagaacgtggtcatcgccaagatggactcgacggccaacgaggtggaggcggtcaaa
gtgcacagcttccccacgctcaagttcttcccggccagcgccgagaaaacggtcatcgac
tacaacggggagaggacgttagaagggttcaccaagttcctggagagcggcggacaggac
ggggcggccgacgatgacgacctggaagatctcgaagaagcggaagagccggacctagag
gaggacgacgaccagaagaatttgagagacgaactgtaa

DBGET integrated database retrieval system