KEGG   Ornithorhynchus anatinus (platypus): 100087250Help
Entry
100087250         CDS       T01045                                 

Gene name
MAPK6
Definition
mitogen-activated protein kinase 6
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100087250 (MAPK6)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100087250 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 470 aa AA seqDB search
MDYLTCGDFTLKAVADPKNKMKVPFVEAIAAVFDAVETLDFLEQILTFSPMDRLTAEEAL
SHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHESEFSEHDWPLHN
NYDIDEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTHYSTEPCWPYPDHH
ENKYCDLECSHTCNYKMRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWKEQSKEKSDKKG
KSKCERNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAGTIQLSLQHESTDVDKLND
LNSSVSQLEPKGLLSKSVSREKQEKGMANLAQLEALYQSSWDSQFGSGGAECFLIDQFCC
EVRKDEHIEKENTYTSYLDKFLRQKEDAEMLEMEPADDGKLGEKESEEGFPDNSGEFLFN
KQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQVPHKTYSSILKHLN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggattatttaacctgtggagacttcactctcaaagcagtggctgacccaaaaaataaa
atgaaagtaccatttgtcgaagccatagctgccgtttttgatgctgtagaaacactggac
ttcctggagcaaattctgacatttagtcctatggatcgattgacggcagaagaagccttg
tcccatccttacatgagcatctactcctttcccaccgatgagcccatctccagtcatcct
tttcacattgaagatgaagtggatgatattttgctcatggatgaaacacacagtcacatt
tataactgggaaaggtaccacgaaagtgaattttctgagcacgattggcctttacacaat
aattacgatatcgatgaagttcagcgtgaccctcgggctctttctgatgtcaccgacgaa
gaggaagtgcaagtagatcctcgcaaatacttggatggagatcgagaaaagtacctggag
gatccggctttcgatacccactactctaccgagccctgttggccgtatccagatcatcac
gagaacaaatattgtgatctggagtgcagtcacacctgtaactacaaaatgcgatcgtcg
tcgtacctagataacttggtttggagggagagcgaagttaaccattattatgagcccaag
cttatcatagatctttcaaactggaaagagcaaagcaaggaaaagtccgataaaaaaggc
aagtcaaaatgtgaaaggaatgggttggttaaggctcagatagcacttgaggaagcatcc
cagcagctggtcgagaaagagagggagaagaatcaaggcttcgactttgattcctttata
gcgggaaccattcagcttagtttacaacacgagtctactgatgttgacaaattaaatgac
ttgaacagctcagtgtcccaactagaaccgaagggtttactgtcaaagtcggtgagccgg
gagaagcaggagaaaggaatggccaacctggctcagttggaagccttgtatcagtcatcc
tgggatagccagttcggaagtggcggggcggagtgctttctcatcgaccagttctgttgt
gaagtgaggaaggatgaacacattgagaaggaaaacacttacaccagttacttggataag
tttcttaggcagaaggaagatgcggagatgctagaaatggagccagccgatgacgggaag
ctcggggagaaggaaagcgaggagggtttccccgacaatagcggggagttcctgttcaac
aagcagctcgagtccatcggcattccccagtttcacagccccgtgggttccccccttaaa
tcaatccaggccacactgacaccttctgctatgaaatcttccccccaggtcccccataag
acctacagcagcattctgaaacacctaaactaa

DBGET integrated database retrieval system