KEGG   Ornithorhynchus anatinus (platypus): 100087297Help
Entry
100087297         CDS       T01045                                 

Definition
(RefSeq) sphingosine kinase 2-like
Organism
oaa  Ornithorhynchus anatinus (platypus)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 120 aa AA seqDB search
ITPELLPRPRRLLLLVNPFGGRGQAWQWCQNHVLPMISEADLSFNLIQTERQNHARELVR
GLNLAEWDGIVTLSGDGLLYEVVNGLMERPDWAKAIKTPVGILPCGSGNALAGAVNQHGG
NT seq 365 nt NT seq  +upstreamnt  +downstreamnt
tgatcactccggagctcctccccaggccccggcggctgcttcttctggtgaatcctttcg
gcgggcggggccaggcttggcagtggtgtcagaaccacgtgctgcccatgatctcggaag
ctgacctctccttcaacctcatccagaccgaacggcagaaccatgcccgggagctggtcc
ggggactgaatctggccgagtgggatgggatcgtgacgctgtccggagacgggctgctgt
atgaagtcgtgaatgggctcatggaacggcccgattgggccaaggccatcaagacgcctg
tcgggatcctcccctgcggctctgggaacgcgttggcgggagccgtgaaccagcacgggg
ggtaa

DBGET integrated database retrieval system