KEGG   Ornithorhynchus anatinus (platypus): 100087297Help
Entry
100087297         CDS       T01045                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100087297
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100087297
   04020 Calcium signaling pathway
    100087297
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100087297
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100087297
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100087297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 120 aa AA seqDB search
ITPELLPRPRRLLLLVNPFGGRGQAWQWCQNHVLPMISEADLSFNLIQTERQNHARELVR
GLNLAEWDGIVTLSGDGLLYEVVNGLMERPDWAKAIKTPVGILPCGSGNALAGAVNQHGG
NT seq 365 nt NT seq  +upstreamnt  +downstreamnt
tgatcactccggagctcctccccaggccccggcggctgcttcttctggtgaatcctttcg
gcgggcggggccaggcttggcagtggtgtcagaaccacgtgctgcccatgatctcggaag
ctgacctctccttcaacctcatccagaccgaacggcagaaccatgcccgggagctggtcc
ggggactgaatctggccgagtgggatgggatcgtgacgctgtccggagacgggctgctgt
atgaagtcgtgaatgggctcatggaacggcccgattgggccaaggccatcaagacgcctg
tcgggatcctcccctgcggctctgggaacgcgttggcgggagccgtgaaccagcacgggg
ggtaa

DBGET integrated database retrieval system